المساعد الشخصي الرقمي

مشاهدة النسخة كاملة : موضوع مميز ◄ تـفـضـلـوا مـرحـبآ بالجـميــع ... ♥ الــدآر دآركــم ♥ ... دردشـة مـنـكـم و إلـيـكـم ►

الصفحات : 1 2 3 4 5 6 7 [8] 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116

معاً إلى الله
2012-02-06, 13:16
نلتقي بعد حيــــن ..

إن أردتم أن تعرفوا مآذآ سأفعل الآن .. :rolleyes:
شآهدوا هذآ المقطع و ستفهموووون .. :1:

و شآركونآ بتعليقكم عن هذه الحآلة .. :rolleyes:


آلاء الرحـــــــمن
2012-02-06, 13:16
بخصوص طبق الجلفة فهناك عدة انواع
الكسكس او الطعام كيما الجزائر كامل نحضروه بمرق احمر و بلحم الغنم و كاين اللي ديرو للمرق الهرماس ( المشمش المجفف بأشعة الشمس يكون له لون بني الى بنفسجي داكن و بالمناسبة مسعد اصل الاخت عطر مشهورة بزراعة المشمش و عندهم مشمش رائع حقا)
و نديرو المردود و كاين اللي يسموه العيش تعرفي الطعام رقيق اما حبات المردود كبار عليه ونسموها محمصة نحضر المرق بالدجاج او اللحم نضيف له انواع الخضر مقطعة رقيق و الحبوب مثل العدس والحمص و نضع له الهرماس ايضا عندما يغلي الماء ويصل اللحم الى درجة معينة من الطياب نضيف المحمصة ونتركها حتى تنضج ...
و عندنا الشخشوخة وشرحتلك الطريقة سابقا
و عندنا الزفيطي و هو طبق حار هذا نوجدوه في مهراس نحضر الفطير وهو عبارة عن دقيق وماء وملح نعجنهم جيدا و نطيبوهم في طاجين ...
ثم نحضر المرق نحضر الطماطم حب ونقشرها مليح ونرحوها و نقطع الفلفل الحار والثوم و نصنع منهم صوص لكن تكون خفيفة قليلة
عندما ينضج الفطير نقوم بتفتيته الى قطع صغيرة ونضعها في المهراس و نضيق له المرق المحضر و نقوم بتحريكه بواسطة رزامة حتى نكمل الكمية ... و راهم ضرك يدرولو اللحم المرحي والزيتون و الكاشير يعني كل واحد وذوقو ....
و عندنا ايضا الرفيس و الكعبوش والمسمن والبغرير و ربما نسيت بعض الاكلات ساكتبها حالما اتذكرها و سأبحث لكي عن صورة للمهراس واضعها لكي لاني لا ادري اعرفته ام لم تعرفيه ....

2012-02-06, 13:17
جاء الما نوض تعمر.......ربي يعاونك

آلاء الرحـــــــمن
2012-02-06, 13:33
هذا هو المهراس عرفتيه اختي معا الى الله؟ للاسف انا لست قوينية ولكننا كولاية واحدة عندنا نفس التقاليد تقريبا


روحي عمري الما و تهالي في روحك .....
اما بخصوص معنى العرش فهو يشبه القبائل سيدي نايل انجب العديد من الاولاد واولاده انجبوا اولاد وهكذا فاصبحت كل مجموعة تنتمي الى احد من ابناء سيدي نايل تحمل اسمه و تنتمي اليه مثلا اولاد عبد القادر واولاد الغويني و اولاد شيبوط و اولاد عيسى يقطنون مسعد وفيض البطمة وعرش الاخت عطر اولاد طعبة وهذا على سبيل المثال لا الحصر ...
و عندنا العبازيز يسكنون في مدينة الشارف
و عندنا رحمان يسكنون في عين وسارة
و السحاري يسكنون في حد الصحاري
و عرش اولاد بن علية الذي انتمي اليه "فأنا علواوية" و يسكنون منطقة اسمها سيدي بايزيد نسبة الى سيدي بايزيد البسطامي ابن عبد القادر الجيلاني.
اظن انني قد الميت بكل مناطق وعروش الجلفة و من نسيته يذكرنا بنفسه ...
هذا بخصوص العروش

عطر الملكة
2012-02-06, 14:33
بخصوص طبق الجلفة فهناك عدة انواع
الكسكس او الطعام كيما الجزائر كامل نحضروه بمرق احمر و بلحم الغنم و كاين اللي ديرو للمرق الهرماس ( المشمش المجفف بأشعة الشمس يكون له لون بني الى بنفسجي داكن و بالمناسبة مسعد اصل الاخت عطر مشهورة بزراعة المشمش و عندهم مشمش رائع حقا)
و نديرو المردود و كاين اللي يسموه العيش تعرفي الطعام رقيق اما حبات المردود كبار عليه ونسموها محمصة نحضر المرق بالدجاج او اللحم نضيف له انواع الخضر مقطعة رقيق و الحبوب مثل العدس والحمص و نضع له الهرماس ايضا عندما يغلي الماء ويصل اللحم الى درجة معينة من الطياب نضيف المحمصة ونتركها حتى تنضج ...
و عندنا الشخشوخة وشرحتلك الطريقة سابقا
و عندنا الزفيطي و هو طبق حار هذا نوجدوه في مهراس نحضر الفطير وهو عبارة عن دقيق وماء وملح نعجنهم جيدا و نطيبوهم في طاجين ...
ثم نحضر المرق نحضر الطماطم حب ونقشرها مليح ونرحوها و نقطع الفلفل الحار والثوم و نصنع منهم صوص لكن تكون خفيفة قليلة
عندما ينضج الفطير نقوم بتفتيته الى قطع صغيرة ونضعها في المهراس و نضيق له المرق المحضر و نقوم بتحريكه بواسطة رزامة حتى نكمل الكمية ... و راهم ضرك يدرولو اللحم المرحي والزيتون و الكاشير يعني كل واحد وذوقو ....
و عندنا ايضا الرفيس و الكعبوش والمسمن والبغرير و ربما نسيت بعض الاكلات ساكتبها حالما اتذكرها و سأبحث لكي عن صورة للمهراس واضعها لكي لاني لا ادري اعرفته ام لم تعرفيه ....

شكرا غاليتي كفيتي و وفيتي
بخصوص الرفيس نطيبوا كسرة فطير ثم نهرسها بالمهراس و نضع فوقها التمر بعد تنظيف و الدهان الحر هذا الاصل و ان لم يكن لديك الدهان نعوضه بالزبدة و نرفس المكونات مع بعض هذ الطبق مرتبط بفصل الربيع عند اهل البادية عندنا يقدم مع طاس لبن لضيوف خاصة لعزاز مثل اختنا معا الى الله و جميع الطيبين الموجودين هنا
اما الكعبوش نقوم بقلي دقيق متوسط في المقلاة و نضعها فوق التمر بعد تنظيف و نضيف الزبدة و نعرك الكل مع بعض و يمكن اضافة ايضا الفلفل عكري بعد ما نعرك الكل نقدمه في طبق و يمكن ان نصنع من الخليط كويرات
عادة ما يرتبط هذ الطبق ببعض المناسبات مثل النفاس
و احيانا نخرجه كصدقة مع القهوة عندنا عادة احنا في عائلتنا طبعا حسب الظروف اننا يوم الجمعة نخرجه كصدقة
بخصوص المشمش نعم منطقة مسعد مشهورة باجود انواع المشمش و على ذكر الهرماس عندي كمية منه في البيت سانقل لكم صورته بعد قليل
اما المردود هو غالبا ما يطلق عليه البركوكس في مناطق اخرى سانقلك صورة عن حبيبات المردود لتوضيح
شكرا غاليتي بيرلالالالالا

هيا الجزائر
2012-02-06, 14:39
المحبة نعمة من الله..
وفقد الأحبة غربة ..
ولقاؤهم أنس ومسرة ..
وهم للعين قرة..
فسلام على من دام في القلب ذكراهم ..
وإن غابوا عن العين قلنا..
يا رب تحفظهم وترعاهم...

" إني أحـــبكــم في اللـــــــــه "


عطر الملكة
2012-02-06, 14:41
المحبة نعمة من الله..
وفقد الأحبة غربة ..
ولقاؤهم أنس ومسرة ..
وهم للعين قرة..
فسلام على من دام في القلب ذكراهم ..
وإن غابوا عن العين قلنا..
يا رب تحفظهم وترعاهم...

" إني أحـــبكــم في اللـــــــــه "


و عليكم السلام و الرحمة و الاكرام
يسعد مساكي منورة الدار و الله

هيا الجزائر
2012-02-06, 14:57
أهديڪـــم أجمــــــــل باقــــــــة ورد في الوجــــــود ~

جذوعـهـــــا : لا اله إلا الله ~

غصونهــــــا : محمــــد رسول الله ~

ثمارهــــــــا : سبحان الله ~

أوراقهـــــــــا : الحمد لله ~

عروقهــــــــا : الله اڪبــــر ~

ظلهـــــــــــا : الخلود ~

مسكنهـــــا : الياقوت والمرجــــان ~

جعلهـــــــا الله من نصيبكم ونصيبى

كل واحد ياخد وردة :1:

http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/418524_319055581465479_172287586142280_792654_1389 706913_n.jpg

معاً إلى الله
2012-02-06, 15:33
عطر الملكة الطعبيـــــة .... والله يا البارح غير الكوفيرطا فوق الكوفيرطا واللي يلقى حاجة يديرها فوق جسموا ...

ماتكثريش تحكي على الزفيطي والشخشوخة لاخاطر اقرب واحد راني انا ههههل

ومعا الى الله راهي تحوس على معنى العرش وتحوس تعرف بعض تقاليدنا العريقة ثقفوها شوية وساعود بعد حيـــن

و أنآ كذلك نموت على الشخشوخة و الزفيطي .. :1:

معاً إلى الله
2012-02-06, 15:43
بخصوص طبق الجلفة فهناك عدة انواع
الكسكس او الطعام كيما الجزائر كامل نحضروه بمرق احمر و بلحم الغنم و كاين اللي ديرو للمرق الهرماس ( المشمش المجفف بأشعة الشمس يكون له لون بني الى بنفسجي داكن و بالمناسبة مسعد اصل الاخت عطر مشهورة بزراعة المشمش و عندهم مشمش رائع حقا)
و نديرو المردود و كاين اللي يسموه العيش تعرفي الطعام رقيق اما حبات المردود كبار عليه ونسموها محمصة نحضر المرق بالدجاج او اللحم نضيف له انواع الخضر مقطعة رقيق و الحبوب مثل العدس والحمص و نضع له الهرماس ايضا عندما يغلي الماء ويصل اللحم الى درجة معينة من الطياب نضيف المحمصة ونتركها حتى تنضج ...
و عندنا الشخشوخة وشرحتلك الطريقة سابقا
و عندنا الزفيطي و هو طبق حار هذا نوجدوه في مهراس نحضر الفطير وهو عبارة عن دقيق وماء وملح نعجنهم جيدا و نطيبوهم في طاجين ...
ثم نحضر المرق نحضر الطماطم حب ونقشرها مليح ونرحوها و نقطع الفلفل الحار والثوم و نصنع منهم صوص لكن تكون خفيفة قليلة
عندما ينضج الفطير نقوم بتفتيته الى قطع صغيرة ونضعها في المهراس و نضيق له المرق المحضر و نقوم بتحريكه بواسطة رزامة حتى نكمل الكمية ... و راهم ضرك يدرولو اللحم المرحي والزيتون و الكاشير يعني كل واحد وذوقو ....
و عندنا ايضا الرفيس و الكعبوش والمسمن والبغرير و ربما نسيت بعض الاكلات ساكتبها حالما اتذكرها و سأبحث لكي عن صورة للمهراس واضعها لكي لاني لا ادري اعرفته ام لم تعرفيه ....

أهلآ بيرلا ..
بالنسبة للمردود .. حنا نقولولو : بركوكس ..
ياك هذآ ؟

و الطعام باين .. و الشخشوخة راكِ حكيتيلي عليهآ ..
و نلحقوا للزفيطي .. سلاطة مهرآس :1:

هي أحب و أفضل أكلة عندي .. :19:

قلتيلي راهم يديروه باللحم المرحي أو الكاشير .. !!!

تآع الزيتون جربتهآ .. لكن لخرين لأوّل مرّة نسمع بيهم ..
أصلا تعدّدت عليا الوصفات ..
كاين لي يقول كي تشوي الطماطم خير ..
و كاين لي يقول لي يغليها خير ..

مممم .. ممكن من فضلك تعطيني وصفتكم ..
سأكون ممتنّة لكِ طوال حياتي ..

صدقيني هي أحبّ أكلة و أفضل أكلة أكلتها في حياتي ..

و منين تعلمتها [ زعمة ] .. نديرها تقريبا مرتين الى 3 مرات في الأسبوع :1:

و كيف لا أعرف المهراس .. و أنا اقتنيتُ واحدآ العام الماضي ..
و زدت فآرنيتو هاذ العام .. أصبح تحفة لا يمكنني الاستغناء عنهآ ..http://www.djelfa.info/vb/images/icons/icon10.gif

أنتظركِ أنتِ أو أيّ أخت أو أخ أن يزوّدنآ بالوصفة الأصح ..
و قولولي ... منين أصلها هذه الأكلة ..

منين بلادها الحقيقيّة ؟؟

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-06, 15:44
هؤلآء شكروا الموضوع .. :)
و من بينهم من لم يشآركنآ بعد .. :rolleyes:

ندعوا الجميع للانضمآم لنآ .. :mh31:

**فارس** (http://www.djelfa.info/vb/member.php?u=121092), ل..ب..ن..ى (http://www.djelfa.info/vb/member.php?u=70682), أمآآآآني البنفسج (http://www.djelfa.info/vb/member.php?u=266516), مبدعهـ حتى فيـ أخطائيـ (http://www.djelfa.info/vb/member.php?u=286319), محمد حانطي (http://www.djelfa.info/vb/member.php?u=134031), مختلف (http://www.djelfa.info/vb/member.php?u=209681), محبة الحبيب (http://www.djelfa.info/vb/member.php?u=245008), ميرة34 (http://www.djelfa.info/vb/member.php?u=354839), المعتصمة بدين الله (http://www.djelfa.info/vb/member.php?u=284397), الامل بالله (http://www.djelfa.info/vb/member.php?u=306406), الشتاء (http://www.djelfa.info/vb/member.php?u=259140), تفاحة12 (http://www.djelfa.info/vb/member.php?u=254567), حميد.ص (http://www.djelfa.info/vb/member.php?u=309744), داعي الله ياسين (http://www.djelfa.info/vb/member.php?u=250236), moustapha (http://www.djelfa.info/vb/member.php?u=531), سآجدْ للهْ (http://www.djelfa.info/vb/member.php?u=332741), سفيان القاسمي (http://www.djelfa.info/vb/member.php?u=269478), sbmwhadz (http://www.djelfa.info/vb/member.php?u=332462), ـ هبة الله ـ (http://www.djelfa.info/vb/member.php?u=306909), عادل95 (http://www.djelfa.info/vb/member.php?u=331957)

http://www.nsaayat.com/up/uploads/nsaayat9ee1edd491.gif الدآر دآركم http://www.nsaayat.com/up/uploads/nsaayat9ee1edd491.gif

السْسَلآَمُ عَلَيْكُمْ ,,

أَعْتَذِرُ بِشِدَّة أُخْتِي مَعآ إِلَى الله و شُكْرًآ عَلى عَلى الدَّعْوَة الجَمِيلَة :)

وَ لْتَتَأكَّدِي بِأَنَّنِي مُتآبِعَة وفيَّة لأَخْبَآرْ الدَّآر و أَهْلِهآ الكُرَمآءْ ;)

كَمآ أَنَّنِي لآَ أَجْلِسُ طَوِيلآً أَمآم الحآسُوبْ خَآصَّة و أَنآ من قِسم امْتِحآنْ هذه السَنَة :19: شَهآدَة التَّعْلِيم المُتوسَط ’’ ادْعُولِي بالتَّوْفِيْق :rolleyes:

كَمآ أَنَّنِي أَخجَلُ صَرَآحةً من وَضْعِ موَآضِيعَ هُنآ فِي مُتنَآول عُظَمآءْ :o أَتمنَّى أَن تَكُون لِي الجُرْأَة فِي وضْع كُلّ مآ خَطَر بِبَآلِي مِنْ موَآضِيعْ :)

دُمْتُمْ بِودّ


عطر الملكة
2012-02-06, 15:56
أهلآ بيرلا ..
بالنسبة للمردود .. حنا نقولولو : بركوكس ..
ياك هذآ ؟

و الطعام باين .. و الشخشوخة راكِ حكيتيلي عليهآ ..
و نلحقوا للزفيطي .. سلاطة مهرآس :1:

هي أحب و أفضل أكلة عندي .. :19:

قلتيلي راهم يديروه باللحم المرحي أو الكاشير .. !!!

تآع الزيتون جربتهآ .. لكن لخرين لأوّل مرّة نسمع بيهم ..
أصلا تعدّدت عليا الوصفات ..
كاين لي يقول كي تشوي الطماطم خير ..
و كاين لي يقول لي يغليها خير ..

مممم .. ممكن من فضلك تعطيني وصفتكم ..
سأكون ممتنّة لكِ طوال حياتي ..

صدقيني هي أحبّ أكلة و أفضل أكلة أكلتها في حياتي ..

و منين تعلمتها [ زعمة ] .. نديرها تقريبا مرتين الى 3 مرات في الأسبوع :1:

و كيف لا أعرف المهراس .. و أنا اقتنيتُ واحدآ العام الماضي ..
و زدت فآرنيتو هاذ العام .. أصبح تحفة لا يمكنني الاستغناء عنهآ ..http://www.djelfa.info/vb/images/icons/icon10.gif

أنتظركِ أنتِ أو أيّ أخت أو أخ أن يزوّدنآ بالوصفة الأصح ..
و قولولي ... منين أصلها هذه الأكلة ..

منين بلادها الحقيقيّة ؟؟

و بالنسبة للمردود هو البركوكس فعلا

اصل الاكلة لجيرانا ناس


بالمناسبة اوجه لهم تحية طيبة خاصة اختي الغائبة ايمي
اتمنى ان تكون بخير و بصحة و عافية

معاً إلى الله
2012-02-06, 15:57
جاء الما نوض تعمر.......ربي يعاونك

نعم و هو كذلك ..
جآ المآء و رحت عمّرت و غسلت و نظّفت و رجعت .. :)

شكرا على الدعاء أخي الكريم ..
و مرحبآ بك معنا في الموضوع ..
مع أنك كنتَ من أوّل الشاكرين للموضوع ..
إلّآ أنّك لم تشاركنا حتى اليوم ..

الدآر دآرك .. نوّرتنآ بقدومك ..

أتمنى لك اقامة طيبة .. و متعة مفيدة رفقتنا


هذا هو المهراس عرفتيه اختي معا الى الله؟ للاسف انا لست قوينية ولكننا كولاية واحدة عندنا نفس التقاليد تقريبا


روحي عمري الما و تهالي في روحك .....
اما بخصوص معنى العرش فهو يشبه القبائل سيدي نايل انجب العديد من الاولاد واولاده انجبوا اولاد وهكذا فاصبحت كل مجموعة تنتمي الى احد من ابناء سيدي نايل تحمل اسمه و تنتمي اليه مثلا اولاد عبد القادر واولاد الغويني و اولاد شيبوط و اولاد عيسى يقطنون مسعد وفيض البطمة وعرش الاخت عطر اولاد طعبة وهذا على سبيل المثال لا الحصر ...
و عندنا العبازيز يسكنون في مدينة الشارف
و عندنا رحمان يسكنون في عين وسارة
و السحاري يسكنون في حد الصحاري
و عرش اولاد بن علية الذي انتمي اليه "فأنا علواوية" و يسكنون منطقة اسمها سيدي بايزيد نسبة الى سيدي بايزيد البسطامي ابن عبد القادر الجيلاني.
اظن انني قد الميت بكل مناطق وعروش الجلفة و من نسيته يذكرنا بنفسه ...
هذا بخصوص العروش

بسم الله ما شاء الله ..
على حساب واش فهمت .. انتم كلّكم تنحدرون من أصل وآحد .. ؟
جدكم وآحد ؟؟

راني فهمت شويّة .. :19:

فيمآ يخص المهراس .. راني خبّرتك بلي شريت واحد العام الماضي ..
و هو أفضل أكلة عندي .. :19:

شكرا حبيبتي على المعلومآت ..

و أسعد بمعرفة المزيد

شكرا غاليتي كفيتي و وفيتي
بخصوص الرفيس نطيبوا كسرة فطير ثم نهرسها بالمهراس و نضع فوقها التمر بعد تنظيف و الدهان الحر هذا الاصل و ان لم يكن لديك الدهان نعوضه بالزبدة و نرفس المكونات مع بعض هذ الطبق مرتبط بفصل الربيع عند اهل البادية عندنا يقدم مع طاس لبن لضيوف خاصة لعزاز مثل اختنا معا الى الله و جميع الطيبين الموجودين هنا
اما الكعبوش نقوم بقلي دقيق متوسط في المقلاة و نضعها فوق التمر بعد تنظيف و نضيف الزبدة و نعرك الكل مع بعض و يمكن اضافة ايضا الفلفل عكري بعد ما نعرك الكل نقدمه في طبق و يمكن ان نصنع من الخليط كويرات
عادة ما يرتبط هذ الطبق ببعض المناسبات مثل النفاس
و احيانا نخرجه كصدقة مع القهوة عندنا عادة احنا في عائلتنا طبعا حسب الظروف اننا يوم الجمعة نخرجه كصدقة
بخصوص المشمش نعم منطقة مسعد مشهورة باجود انواع المشمش و على ذكر الهرماس عندي كمية منه في البيت سانقل لكم صورته بعد قليل
اما المردود هو غالبا ما يطلق عليه البركوكس في مناطق اخرى سانقلك صورة عن حبيبات المردود لتوضيح
شكرا غاليتي بيرلالالالالا

و الشكر موصول لكي عطوووووورة ..
زدتي شهيتينآ بتلك الحلويآت ..
نموت على الحلويات التي تحتوي على التمر ..

و للأسف أعرف في فصيلة التمر .. المقروط فقط و المبرجة .. :o

أكيد سأتعلّم منكنّ ان شاء الله .. :19:

المحبة نعمة من الله..
وفقد الأحبة غربة ..
ولقاؤهم أنس ومسرة ..
وهم للعين قرة..
فسلام على من دام في القلب ذكراهم ..
وإن غابوا عن العين قلنا..
يا رب تحفظهم وترعاهم...

" إني أحـــبكــم في اللـــــــــه "


أهديڪـــم أجمــــــــل باقــــــــة ورد في الوجــــــود ~

جذوعـهـــــا : لا اله إلا الله ~

غصونهــــــا : محمــــد رسول الله ~

ثمارهــــــــا : سبحان الله ~

أوراقهـــــــــا : الحمد لله ~

عروقهــــــــا : الله اڪبــــر ~

ظلهـــــــــــا : الخلود ~

مسكنهـــــا : الياقوت والمرجــــان ~

جعلهـــــــا الله من نصيبكم ونصيبى

كل واحد ياخد وردة :1:

http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/418524_319055581465479_172287586142280_792654_1389 706913_n.jpg
و نحن نحبّكِ في الله ..
يا سلام عليك يا هيّآ الجزآئر ..
دائمآ بخطّكِ الأزرق الدافئ تبعثينا فينآ جوّى من الهدوء و الراحة

تحياتي لكِ


سآخذهآ كلّهآ .. لأزيّن الدآآآآآر دآركم .. :19:
و عليكم السلام و الرحمة و الاكرام
يسعد مساكي منورة الدار و الله


معاً إلى الله
2012-02-06, 16:10
و بالنسبة للمردود هو البركوكس فعلا

اصل الاكلة لجيرانا ناس


بالمناسبة اوجه لهم تحية طيبة خاصة اختي الغائبة ايمي
اتمنى ان تكون بخير و بصحة و عافية

آآه .. كنتُ شبه متاكّدة من ذلك ..
لأنّي تعلّمتُ مبادئ طهيهآ من نآس المسيلة .. :)

و أتمنى أن أتعلّم المزيد .... :19:

و أكيد لن تبخلن عليا أخوآتي في الله .. :)

ربي يحفظك غااااليتي ...


آلاء الرحـــــــمن
2012-02-06, 16:14
أهلآ بيرلا ..
بالنسبة للمردود .. حنا نقولولو : بركوكس ..
ياك هذآ ؟

و الطعام باين .. و الشخشوخة راكِ حكيتيلي عليهآ ..
و نلحقوا للزفيطي .. سلاطة مهرآس :1:

هي أحب و أفضل أكلة عندي .. :19:

قلتيلي راهم يديروه باللحم المرحي أو الكاشير .. !!!

تآع الزيتون جربتهآ .. لكن لخرين لأوّل مرّة نسمع بيهم ..
أصلا تعدّدت عليا الوصفات ..
كاين لي يقول كي تشوي الطماطم خير ..
و كاين لي يقول لي يغليها خير ..

مممم .. ممكن من فضلك تعطيني وصفتكم ..
سأكون ممتنّة لكِ طوال حياتي ..

صدقيني هي أحبّ أكلة و أفضل أكلة أكلتها في حياتي ..

و منين تعلمتها [ زعمة ] .. نديرها تقريبا مرتين الى 3 مرات في الأسبوع :1:

و كيف لا أعرف المهراس .. و أنا اقتنيتُ واحدآ العام الماضي ..
و زدت فآرنيتو هاذ العام .. أصبح تحفة لا يمكنني الاستغناء عنهآ ..http://www.djelfa.info/vb/images/icons/icon10.gif

أنتظركِ أنتِ أو أيّ أخت أو أخ أن يزوّدنآ بالوصفة الأصح ..
و قولولي ... منين أصلها هذه الأكلة ..

منين بلادها الحقيقيّة ؟؟

هذاك هو المردود و صحاب بوسعادة يقولوا عيش و نعرف صحاب الصحرا يقولوا البركوكس
اما بخصوص الزفيطي فهو سلطة و طبق ايضا كيف سأشرح لكي ....
اولا بخصوص السلطة افضل كي تشوي الطماطم و الفلفل يمدو بنة اخرى و باش ما يطيروش ويدقوا مليح ديرلهم الملح و كي تحطيلهم زيت الزيتون يكونو روعة انا نحب نكثرلهم الثوم تعجبني بنتو...
اما بخصوص الطبق فكما قلت نحضر الفطير و هو دقيق و ماء وملح نعجنوهم مليح و نطيبوهم في طاجين و نفتوهم بعد ما يطيب الى قطع صغيرة .
ثم نحضر المرق نشوي الطماطو والفلفل و نقوهم مليح و من نرحوهم و نكرفجو الثوم في كاسرول نحطولهم الزيت نقلوا فيه الثوم و نضيفولو الطماطم والفلفل و نخلوهم يغلو شوية و نمرقوهم بصح ماشي بزاف الما ... بعد مدة نطفوا عليهم
نجيبوا المهراس نحطوا في الفطير المفتت و نضيفوا لاصوص اللي وجدناها و نخلطوها بالرزامة مليح حتى تتخلط و نديرولها شوية زبدة في الاخير ...
اما بخصوص اللحم المرحي نطيبوه مع المرق و الكاشير او الفرماج نضيفوهم وحنا ندقو في المهراس
اتمنى نكون فهمتك اما اصلها فيعود الى بوسعادة ...
ظرك نزيد نكملك التقاليد كنت نستنى فيك تدخلي برك باش ما تتلفلكش....

آلاء الرحـــــــمن
2012-02-06, 16:25
هذه خارطة الجلفة و هي منطقة سهبية تقع على بعد 300 كلم عن العاصمة تحدها شمالا المدية و من الغرب تيارت و تيسمسيلت و من الشرق المسيلة و من الجنوب الاغواط ...
هي منطقة فلاحية بالدرجة الاولى و تشتهر بتربية الاغنام حيث تحتل المرتبة الاولى وطنيا من حيث عدد رؤوس الاغنام و يعرف لحمها بأنه من اجود انواع لحم الضان ...
و من حيث الزراعة فأغلب السكان يقومون بزراعة القمح والشعير ....

عطر الملكة
2012-02-06, 16:27
هذي صورة للهرماس


معاً إلى الله
2012-02-06, 16:30
هذاك هو المردود و صحاب بوسعادة يقولوا عيش و نعرف صحاب الصحرا يقولوا البركوكس
اما بخصوص الزفيطي فهو سلطة و طبق ايضا كيف سأشرح لكي ....
اولا بخصوص السلطة افضل كي تشوي الطماطم و الفلفل يمدو بنة اخرى و باش ما يطيروش ويدقوا مليح ديرلهم الملح و كي تحطيلهم زيت الزيتون يكونو روعة انا نحب نكثرلهم الثوم تعجبني بنتو...
اما بخصوص الطبق فكما قلت نحضر الفطير و هو دقيق و ماء وملح نعجنوهم مليح و نطيبوهم في طاجين و نفتوهم بعد ما يطيب الى قطع صغيرة .
ثم نحضر المرق نشوي الطماطو والفلفل و نقوهم مليح و من نرحوهم و نكرفجو الثوم في كاسرول نحطولهم الزيت نقلوا فيه الثوم و نضيفولو الطماطم والفلفل و نخلوهم يغلو شوية و نمرقوهم بصح ماشي بزاف الما ... بعد مدة نطفوا عليهم
نجيبوا المهراس نحطوا في الفطير المفتت و نضيفوا لاصوص اللي وجدناها و نخلطوها بالرزامة مليح حتى تتخلط و نديرولها شوية زبدة في الاخير ...
اما بخصوص اللحم المرحي نطيبوه مع المرق و الكاشير او الفرماج نضيفوهم وحنا ندقو في المهراس
اتمنى نكون فهمتك اما اصلها فيعود الى بوسعادة ...
ظرك نزيد نكملك التقاليد كنت نستنى فيك تدخلي برك باش ما تتلفلكش....

و حنا نقولوا بركوكس .. بصح منيش صحراوية .. :)

فيمآ يخص الزفيطي ..

أنا كيفاش راني نديرو .. كيما علموهولي ..
نحط في المراس الثوم .. تحبي تشويه تحبي لالا ..
+ الملح + فلفل قناوة هذاك الأحمر اليابس ..

و تهرسيهم مليح
في نفس الوقت تكوني تشوي في الفلفل
و اذا حبيتي تشوي الطماطم أحسن و كاين لي يغلوها في الماء ..

نضيف الفلفل للمهراس .. + الطماطم + طماطم مصبرة
و نهرسوا مليح
في تلك الأحيان نكونوا نحضروا في الفطير ..
كنت نديروا بالسميد و الملح و الماء..
لكن مؤخرا أصبحت نديرو بالسميد و الفرينة و الماء
يجيني خفيف أحسن

كي يطيب نفتوه ديراكت داخل المهراس باش يقعد سخون و نهرسوا مليح
و اذا كان الخليط ناشف نزيدوا شوية ما سخون
و هكذآحتى يتخلط مليح

و كآين لي يزيدوا في الأخير فلفل عكري حار ..

و في الأخير نضيف زيت زيتون و حشيش مقطفة ...

مآ رأيكِ في هذه الطريقة .. ؟؟
تعلمتهآ من مسيلة ..


آلاء الرحـــــــمن
2012-02-06, 16:38
و حنا نقولوا بركوكس .. بصح منيش صحراوية .. :)

فيمآ يخص الزفيطي ..

أنا كيفاش راني نديرو .. كيما علموهولي ..
نحط في المراس الثوم .. تحبي تشويه تحبي لالا ..
+ الملح + فلفل قناوة هذاك الأحمر اليابس ..

و تهرسيهم مليح
في نفس الوقت تكوني تشوي في الفلفل
و اذا حبيتي تشوي الطماطم أحسن و كاين لي يغلوها في الماء ..

نضيف الفلفل للمهراس .. + الطماطم + طماطم مصبرة
و نهرسوا مليح
في تلك الأحيان نكونوا نحضروا في الفطير ..
كنت نديروا بالسميد و الملح و الماء..
لكن مؤخرا أصبحت نديرو بالسميد و الفرينة و الماء
يجيني خفيف أحسن

كي يطيب نفتوه ديراكت داخل المهراس باش يقعد سخون و نهرسوا مليح
و اذا كان الخليط ناشف نزيدوا شوية ما سخون
و هكذآحتى يتخلط مليح

و كآين لي يزيدوا في الأخير فلفل عكري حار ..

و في الأخير نضيف زيت زيتون و حشيش مقطفة ...

مآ رأيكِ في هذه الطريقة .. ؟؟
تعلمتهآ من مسيلة ..


طريقتكي صحيحة و هي الاصل وكانت امي تحضرها بهذه الطريقة و لكن من ناحية انو يجي ناشف وكي تزيديلوا الما السخون باللاك ما يتخلطش مليح
امالا ولينا نخدموه صوص و نرحو الطماطم والفلفل و لا ندقوهم كيف كيف و كي نوجدوا لاصوص كي تولي تاكلي و لقيت اللي في القاع ناشفة تزيدلها لاصوص وترجع كيما لاولة هذي فكرة جديدة تعلمتها من صديقة العائلة ولما جربتها وجدتها احسن من الطريقة الاولى ...
جربيها و ردي لي الخبر ...

عطر الملكة
2012-02-06, 16:44
(عرس اولاد نايل)

تفاصيل العرس :
أولا تكون الشوفة:وهي ذهاب بيت العريس لدار العروس من أجل التعرف عليها وعلى اهلها ورؤيةالعروس لا يتم الذهاب الا بعد السؤال عن البنت واهلها وعلي حسب مانعرف يكونوا يعرفوها من قبل وطبعا يأخذون معهم علبة حلويات أو فاكهة مثلا .....
ثانيا تكون الخطبة:عندما تعجبهم العروس بعد حوالي أسبوع أو أقل يذهبوا أهل العريس لدار بيت العروس من أجل خطبتها رسميا ويأخذون معهم في الغالب خاتم الخطوبة و قاطو من الحجم الكبير(بياس مونتي).....بالاضافة الا عدد من النساء.وتقوم ام العروس بأعطاء مبلغ من المال يدعي زيارة.....
و في المقابل يكون الرجال في الصالون يتكلمون في التفاصيل و قطيع الشرط
ثالثا الحنة:وهذه تكون بذهاب أهل العريس مع مجموعة من اهلهم لبيت العروس ويحدد هذااليوم في الغالب بيوم الخميس ، يأخذون معهم (الفاليزا والتبق) ويكون في الفاليزا مجموعة من الألبسة
علي سبيل المثال:قماش،فستان،حجاب،حذاء،صاك،ماكياج
...ملابس داخلية إلخ
ويأخذون لها كذلك خاتم أخر وسلسلة أو أساور(حدايد) او ممكن يكون طاقم من الذهب يعني حسب الإستطاعة ، اما في التبق فيكون فيه عطور، صابون، سكر مول ، حلوةالدراجي ، الشمع......إلخ ويسهرون عند بيت العروس التي تكون هي بدورها قددعت كل أهلها للفرح معها وفي هذا اليوم تكون التصديرة وفيه تلبس العروسأنواع متنوعة من الألبسة كــ: روبة السهرة(سواري)، فرقاني، روبة سطايفي،تلمساني، ملحفة، هندي، .....إلخ وطبعا الفستان النايلي يكون حاضرا بقوةفلازم على العروس النايلية أن تلبس اللباس التقليدي النايلي ممكن يكون حتىفستانين وعندما تلبس الفستان النايلي يقوم نسوة بعمل الحنة لها وسطالزغاريد والأغاني من النسوة .......
رابعا يوم الزفاف:ويكون بجلب أهل العريس العروس لبيتها الزوجي فتلبس العروس الفستان الأبيض ويأتي أهل العريس وهم مزينيين سيارة العروس ويقوم ابوها بخراجها تحت جناحه وهي تلبس البرنوس الابيض فوق الفستان وياخذونها إلى بيت عريسها والذي عند وصولها تؤخذ مباشرة لتقعد وسط النساء في مكان مخصص لها مزين ويقدم لها الحليب والتمر وتقوم مرةأخرى بالتصديرة مثل ما فعلته في يوم حنتها تعاوده يوم عرسها وتجلب معهاهدية لزوجها وهدايا لاهل زوجها تسمى بالتباع عندنا وهي عبارة عن مجموعة من الأقمشة التي تعطيها أم العروس لأم العريس لتوزعها على أهلها بمعرفتهاوكمية الأقمشة تكون حوالي على أكثر تقدير 7أقمشة أو محارم وخمارات......
خامسا صباح يوم العرس:في صباح يوم العرس تلبس العروس في الأغلبية فستان نايلي وتجلس وسط النسوةمرة أخرى لتهنئتها بالزواج المبارك وفي نفس الوقت تكون قد جلبت معها مجموعةمن الحلويات المختلفة التي تقوم أخواتها مثلا بتوزيع الحلويات التي جلبتهامعها العروس على النسوة وكذا تأخذ معها العروس : السكر ، القهوة، الحلوة،الريحة، الصابون وتدعي بالقصعة وتوزعه على أهل العريس الحضور..
سادسا يوم السبوع:وهو عبارة عن ذهاب العروس لبيت أهلها بعد أسبوع من الزفاف تأخذ معها لبيت اهلها فاكهة ..
وتقعدعند بيت اهلها على أكثر تقدير 3أيام وعند عودتها لبيت عريسها تجلب معها من بيت أبوها : الشواط ، البيض المطبوخ، الرفيس، المشوي ، الطعام ويمكن انتزيد عنه الفاكهة .......
إذا هذه عادات ولاية الجلفة

منقول للفائدة

آلاء الرحـــــــمن
2012-02-06, 16:54
اما بخصوص لباس الجلفة
فالمرأة تلبس اللباس النايلي المعروف و هو هكذا
http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wCEAAkGBhQSEBUTExQWFRUVGBgaGBcXGBgcGBkcGBwXFxcXGh YYHCYeGBojHBgXHy8gIycpLCwsFx4yNTAqNSYrLCkBCQoKDgwO Gg8PGiwkHyQsLCwsKSksLCwvLCwsLCwsLCwsLCwsLCwsLCwpLC wsLCwsLCwsLCwsLCksLCwsLCwsLP/AABEIAQMAwgMBIgACEQEDEQH/xAAcAAACAgMBAQAAAAAAAAAAAAAEBQMGAAECBwj/xABCEAABAgQDBQUFBwMCBgMBAAABAhEAAxIhBDFBBSJRYXEGEz KBkaGxwdHwBxQjQlJi4RVy8ZKyM0OCotLiFiRjF//EABkBAAMBAQEAAAAAAAAAAAAAAAECAwQABf/EACwRAAICAgIBBAEDAwUAAAAAAAABAhEDIRIxQQQiUWEyE3GBk aHRFCMzUmP/2gAMAwEAAhEDEQA/AOdty0y1VqSFMplGwJfwqSWuC2r+sBY/AKTvJBKSkGw0IdzYAKAZx5h2gWRi1y6EMmYDKQ6FbyTXSaczd3 OYy0sIseG7qbJJQDLcUqSDZJ4Xs3AhtNIwzg5bQYuiuyUu1JVU QQUgXN+IzGRyPsiVCLJqBGb/ADd8+TGGKtg76USgTMSKwVKSXBcZZD2fGFQnVIUpK3AdnLgln1 FlH5Rl4t7SKpWTYmcEpNJLK3XIvbJw2T30jvALHeJBXQQQ60je QHuqwcsGIv6QBhsQpRD2pLva2bFgLZnTSLv2V2XKPcTlMqZMmJ ruGSQVClhxISq/KO4SsKhZ1hcStcqYV4yaqVLs4QSCTkGJfQ2JDEZl3LTsliJZSF FJmYkMpIejwuGSSq+6XOpvbKLOiembLCpaCoOWJASk6EKquUno cgWLCBMbsvCoqnmWE92kq3SoDdFRICemgjTD08m+Uf7i18FO7T YoT1CYoJSQaFU6q0vkSx46QvxODqZWFQsKIBUhCK5Q0dSQSZbs S43c2h92C23JxUtctUiWFyqWLAlQV+bechVSSW0BHCL4iYwIGk GHontyldj20Ujs7hZqcKe+RQqtTWYEWLgcHJ9IIYxYdoqKxYZQ nMqPD9VD36PSwSfHZHIF472ls1U0SwkApqNYJSCzaFSSBe5sTb rHSA0ESJpB5Q/pIrntByrlGgJfZmahR7tKKR4WXc6VKKmNRz1z1hBjuz2MUszJ6 UyklkilQOT0mxLqzbK50j0JK3MUP7W9skSpKAdwrXU2pQlqToQ 6gfKPel6PHtnmNMNwknES+/VMl92kmVMSqgABSK0Fw7AhKEWFmUCLvAmN2quZLVW6XVcDMKuD Y3GRsLXOUW7sziqsFhxNpJVKTVckFxk6s7aRyNlSkVAOUO4STd JtZJ0GefE5xl9V6eSjyu0gJNso0raZVQJYoIDEuo2dlGkZ8wOR DQrw+1CmaJsgJBQbuLkAKQVF/wBqy/JKHyBh12h2eE1KBNSnJIFISnWz7w68+MUMbQCZplWN6Gdk/ucgvo3FuFoz4YKStM9DFhw/oynklvwv2/yXDs7gmwiXU6RdQSRWSxUQln3QeLPfOHUvaiZ0xMgJCkoSSoKK QUlYIqUl3oKXZrX6QNhZ6ZsgypSE1UkBSUSwE7rISCtwpZ5gsB 6g7G25QUFkrUkUTQ4uAkUhQGSgCliz+HpE8mPjcvk8+M09h8xF KloWhFJYFbE7qrcczSA2bgxTto7JkDGkGYJcpcxLLWSWQoAki7 kAWB0YaxY9t7QJlIUumsFSQz7yVA3cNlvAHSrN86mMP95xISlI deqwwQEpzJBDBIBLcuJaKel0xZyLsVo/5eMwiZf5BRIDJ/KGViAoMGzvxjUUv+loFu+Rb/8AMfGW/rGR6PJfBPmjMXs0yk7tqAneOZd1BNrhrkHg+ojrB9oVCYgLT4i oKL2ZSiUhmyFVi+SlcYBxuNWtdfeBKTcIJ8SbAEc2+PGAV4moJ/Wm/wC0tw5sAW5wjtsCWi5f1BcuZ3kqmpIZ1kAB3AzYcMzpziuzpM2 XJpCx3SpqK0hswFALZn1bzFoj2htWpcxMtylKLc1hQJIGuovFr 2LtDvMOonunVMpKFskIt+4EgkuLAvQwzeEcpwV+C8Emhd2P2EC ZnfJmA7tCGIUo72ihknUmwPoStl7PnoUlSVd2sKA/KU1AkOdDcG8Sd4qtcwE1kMwJNRSN1KhrmGZxmRD3sjgJk1AVNB ABFSFi6lpAzfJOSmtpaM8eWWftKVfRatnzp3dAT1DvHNTMw5WD G2vOONqYmpCxe8tQSk0uXBFk3IfK/GJAp1E5ge3/ACW9sA7VnMQAQ9TEtdSlcOAFvTlHtKoxpGlY10eefZpiacQpIY KMtDE2diQR1NudvKPX5SSlW8zEWGoLcdc48k7GyH2nNQkkB1p8 kqdtGYFo9XlSQkBnJbVyz59HLwIEX+KRIMSASkgcQesD4iSDAk 1KhURop+oP17I1KxTlo8X1Uam0zRCFbRLKw4dzpHctbrAAsHJ+ usQT5pFgHJgyVg2pBN81DnZh0F4b0mNylrpHTfFW/JMJzAkmwBfJgY86+1QgSsMWPjmXNiSUp5v6x6JOlpJul8rt6GP P/tRwtMpBAJQFi2gqB9Bu6EZ8o9ifRmq0Pfs/2jXgcOFm4QQA1mSopAyYWAHlDzErAXbI2PKKt9mIJwiLMwUORF a2z98WLGopURxv/ECT9uy8Iq6+imYt1qVUUmWsWCCGqYBkpFkjLqX4xW5spJXMTJl IXYglQKi51EzJJcWKT5aQ97S7Sw0pRlJQX3isghL5OAreY53bX QmEo7ViQgISlCCgBlIYpWzLSp+Nm4717vHl4o8L1sw5sM8dOS7 6CF9o5MqUqSE0TAAVBTAgkAnu1gkHMZ3NrCOezO1pax3NK0ZEq 8aVl94pC7oJsSHIfIBy9SRgUrSuctRC3BSm1JKirxKXZnps130 h+naiJbpmJ7uYBUySki4LEFJIDsCxuH6GLzipLZn/AB6GPajaiPvCZaAgVkFyncQnwv3aTnYkgWgTG9nJaZRxJVMMtB AUtO8Soks6hZ3tbKztE9cvEYcAynn7yQolW4nxlTpId1FmUCzk jKLLsbHoOGxCiAe5lL7yXkmhKHDA2CSrQubZaxGD4ukr+SlX2y oYfspPmIStGExBQsBSTWi4UHBYl8jGQCO2WMFhPmADIAlgNAL5 RkabQnBfIoRgCtJV+UBIljN73HtJ6wUjDBVwFgkXBYpJAs3qQ3 AQX2aRMnVqWl0IQlYJswKu7dL3IqDVDI25Q4l4RKNUkZ56KJY+ UM2kzra8CjYexmny3IDqU5VYAUkl7jgRex1i3bSlo7lKSoKIUh QWwAqDBLMALuMrNytEOB2UMQvunl1LBFRDkFIJLMcyHvDb/wDnJZLzlKoO6C5APG5PAe2M/qEsjTi6NOFScBfs2UmWhK3dYdSWBIABzZxmyrcydRFu2TtILk6 1hxMcNQdU81G2usLJPYBSVH8bxsDuaDJgVWb4mDMHsc4ZQHeVJ U7IyAUAN4B72Deh0ifpk8eTfk0QVMZJ3Q5ySHPXQerxX9pznWh JOSSom+ZuSwzLMAOJh9OyCTYHeV0GUVfFrqnv5tycEj0tHozZv xK7Yt7KbPmDaU9a0lAIWUrU2RWWLuWfLyj0HCTxUUGYDwsznhU c4WbMx0uZNWl0FSbEBqt0kFw/G4tkQIPxWESpK3DghvdfraHitWYml0GSCgKIqqGTO/m8YJCFvTuqGYPzgPAoSkXcAZjQHVo1jsWyT3abNcvvW4emWvKB khCa96O4u/a2HJmBNgLuQ7e0nQaxHiyhS0l3bTjAGBx6lioptpxAFmMFSt0W 0yA0gxpLRzhT32dYvaCTuJJsC5CXa7AXvodPOK5202SrEYKkKB V3iVAkdUt4cw/DlDyUk0Bbbw92vlnCvtFj0yZJmLUUpCkuw3rkOA1yWc9A/Uz6CoRSOewuB7rClBYqSaXHr6QxVMJd8/q8Cdjp4mS1LFwov5KAIMG4qWyjCO+KLxpTaPL+1ezVzMUsJYBy TyAAFR4uGbqRxiv7Xw3dIMrNOhADnJzxe2sXDbkxQxM1aF3qAB bIpQlwNHT7CoGKxtqU6FKVdRa9mLkAAFNsr24RgjJuVGH1eeWS SjLwKMfNMwhCULlvSQhRKnGhcscr5HyhliOzs2RIUJqygi6ZQu anSd8WpdJcG5tpC+dLWBLFRDOQxZiNRwL68oJwacTN31ImT5SS 5d2KQSS682sbvoYuvoxtjaRtmaihC0KWmYgFLO9N0lmB1qtZos 2yJbyp0tSm76Xvpe9JcC7EZknXPKE52z3qzh5oQApCSVIAV3aq QphNAeWseEkWdLGLv2Qw/fd2kKX3culaioBPerKaCFBJIIDG1s75h82bG5VxdMbHSdsr2H7 GpCEjupat0XOZtmd7WMj1b+jSv0D2/OMhv0fUf9l/cpyh8Hzthe07MRLTQgKQJJeiiYoqoBBc75K952IEZIxoUh7Bgp w9zYNb6EI5EohJDag87OwGbZ+6L9g+yMqdMXKvLSJCZkhab1eH eWC7uGJS+alMwaLzoRe4Ur2guVKE6WQDLmy2NQqBCSrw50mlic rtrHu7ggaPf4x4/wBm+xUwYl8SkBEtSHS/iUSkik/pa/oI9WTigYjKSWkaMeOVWGAXhfilJCXUKjVugFiTwfh8oJ+8iEu2 sUElHAqPXIk+4+sNipzNGLG26M2gspBCvEvPkB9e+KzOmfiPyP uL+xoZjEhToUd45KJzGuerQrN5o6j2kP7CIvJ2ejjVLYiG0Dht srNwlZZnYFKhSOv4iUnyPUeinGkAFyrdCioMFXe7eE5cs48x7e 4Q1y540pQeW6CD61RbdlY4TJIU/wDyE+xxDcmujFCHucWWKXtOoMK9HdPHziJe0XOVQNsmzLfpNvn ECZzq80/7VfKNYcP3fCkH0MHk2WUEguXj0pAEtgM3vlcm7HLhziROPUT4n P8AarUA8hrEOEUKUgBnKgfRXsiam5/uB/7RD2xXFWczNoFI3qi4cCyRpwc68RHnn2n7TCxKkhvGVEDJmpBY a7yvQxbZ6zS5Oh96Y88xSvvG0VXdKMrPZNm4C7i/HpEubbFyQSVLtno/YtJl4cDLdA9g90PJlxfMe3nAPZ6X+CnoD8DBq0sD0tD+BnXI8z 7UYlUvGrd2JStI0IKQguHYsUN5GOv6IvEVGSlkJ3VEndSFO5CS RdtBbN2jn7RKjOkpCf1sQ7qUpSAxA4AJYfuMdI7Qzk92JYSJKW eUtIKZpIFdSgk1FVxpSGGjxgyQV2ns83OuM9/JT9tqSFiguziqzEflIbRuWZMaTjJik93LqKCzhVVg/gJ1BygvHbOImFLpHCnIOHCb5Xs51frA2N2dMkCWpTpMxIWni1S kvbmn2RWLVUJnjBS9hbuzkxMymUhMiXUWWmpKyoJUkqQUkOkKK RmMicwYvHZLZUzCKSFBKpcwtuFRAUSSFUnwl7FgAxtHk+yJMpY QUomKxImhW6QQwJUVUlJA0uXAKci7RY5PaxU8gIKEKFRU/dSwoy7j/wC1NC1zJp/6RaxENSbIx0e4RkVjB9oJhloNeFulJ3pwquBm1n6RuNPJHHkIV KSLJyJIdyAS4y5MDEGzu1KpM5c1EsTCE0AEkMN0DLMCltPFygF OKSVpqcJDuBmWGlwztm9ng7YOyvvS5qZKKUpSlRClVEZMmoC7l zkbAdYzVa2dFNO0WTYnbcqU89DOpypF76Ok3YDgSeut6w09KgC lQINwQXB5iPLFyKM7EZ/XDIuC0XTsMquUtJHgXa/6g5HkQX6vrEnBN6NWHNLplpSgm+cI9vh5iBwC/wDaYey5MKdoIdajwSr3RSGPi7PQwSuRXpxuRkpLN6W+MQomVKf IhyRwa5PrSIJ2rJ/EBGqT7Akw02L2VVMpmKWkJzAAdRY5F8r9YKTs2TnGEeUhRtrZH f4WYj8xMuk8FafEQq7I4WYiSRMDWW13LOl3/wCqqLvMwRllKCCDUGBZyEg71jxMVTa21U4WUCp2WCwAckkgG+g ZtWt0hnZluN8x7JVvj+5H+1USSi/d/wBvuUkwv2bjUzClQNiqWR/pP+IZYVmR/afemGiUsnwgaXLcuStR8ibew+2O67f6D8I4TKpTLHIH1KI5npZ J6f7VGKSYvkWY5W4UjPeEI9g9mTJMwkhalEEkBhrb3xHtDb1OJ RJCa3UQq7M7tfyfoIteyZgqAaorIAyz8+sZt2c2rv4G2y0UoA4 X6g5iFuK20lcwy5RJTmo83G6PnrEvarDzZMpBCkpCjSaXqvcB8 qWBfrFd2SN8n6+rRVya0NghGaeQK23gqsVglcMTLS4z32y80CE fbLY33PFKGaVuqWS2RzFgA6S9g1qYtm2JZKEKT4kzJKkE5BdYQ knkCq/KCu0/ZZc7Dnu1VqlATUKbfVNDlbK1CwwAuAQng0JKPKzzPWJOaPMsJi pffA4lJMs0qZi6t45DUWUOYB1h12k+7TcAigpNCxLkpUSlSRQF TFM7m7Ju3hTc6q+004Txhpksb3cUqFiSqWpZWpuYWFXzhDNxqq aCCLZGxILqB55vfOrkIlVPRmlaVFkXskSMIyJqpUxaQqg92O9e kAgFaZqZai4BUgjw31NUwuGJWE5FwLghj9aQxwe1VDxKqISwe5 YUsmq5LAWD2AYaQtxGJJnqmJmLlFRJUQSoE/2vlyJIaHW9ErO0i2afOp/NhnGQ6l7fngABWHNhcy5rnmzRuBR3JlTwkpRBy3f1AEMdWUDfh aGCZwJCaqgX31DeLpACVPoGTbINZ84ZTthFJHGpm626M4HrGxs tHd1OHfLyB48z6Rbs7nRzJwFB/CUZlSUkIpINZZ0KB4XFQsRe2Q9W7G7MMrDMrxLLqGYBYJCQrWw BfnHm/ZnEoXijQ4DEAKIdwA5DAOHB0sM7uY9Z2TOpQhJIALgWyIAU3mH PlEoLbs1xikuSGaRbMeR+UJMV4Jh/aW9D84ezJg8hoeOgeEWJ/wCGocX+UXRr9N2xLtMXQeYHqGiz9k5wVICdUliPUv0sfQxW9oJ dPn7hDns0pkBY/LMKVf2zKSPRZB6FUTX5Gj1n/D/Ib2uxZRIpTZSzmMwBnf2eZjz3aeEViJKpZTUQhktZmUC54uHHQ xdduza5raAFvd8YDw+DCRlmz+/3D2wzTbEwwUcVPyecdjNq91N7ia6RUmknIEG4J4Ugt/aY9BwywUApIO4A72FS2u2VgYqnarssFrMyXurOZbOzB+fPOANl zZtYlzUEK/Xak5sScgbN8BAcqDjTjp/1PQZm15KmZfhS29Yu6MuIsYU7d7USJSFGuo/iUhN3e4H88IVYmUQkkM4Bbnaw87esViRsWdPUFzgUpLsniM7DQ ZO/D0CychpLjqO2NOyWzDMWcUvNRNL8Sd5Q5ZAdDFpmgpW4sUqDcj SlQ9oifDSAJSAkMAAAOQiTFSMzxKFewJ+EK1ex8aUVQb2zx4my MOofm3uhYAjyLiEGxk+/5x1jSTKCX/4cxm5LBIIDcUq11EFbEw7p8x8YL3KymGKx4eP2xwmRXQkh3KLc WWlXwi5RVMKaVy/7h7wItcXgeR6z8keJ9rdjnCbQCfyLJWgsBZblSbWsoENwIis4/ZmImzQRLWpUxRCKUkhVLAhObgWcDKL59qO10TpqJKQUrkLVUtQ Z3CSAlnJBzuNBxib7PJs3vyJZFJIK90WS9w5FQcksxza0ZqSnS LKOXHh5uOn5POMfsZUtUwKql91LSqaFi4mKCWlgJzqUoAHJnJL B4UyFiplW4PqPhHtP2nbPShIUlMtCZq6piikkqmJSEy3IuN2oB gczZ7nzDFbFnmdMQhBXMF5omFze7d3+UAuxd8ssoo0k6PMewYT E6i8ZHatnYgFjhVgixsrTqY1CcBeLCJe2q0u7hh4uRyI9YkSKg srNBWl5aaF/iKJINLApAF3JIAvwitypakpBFg7et4NKZiiBUpkuBvEAXJccHN 7aweKsYfSdlmUtKgUpmJZSVoUlSSC4BBDpINxdxoY9A7G7RM6X LlvvSlrWol2akpQByPei2lHMRSsHhphwxmqC50wqYpADEAKTUa WJUxVvFySzvFv7IYhK8KDKIMxEwqSRqSwVLUGdiAbkjxBrpt17 LqLj/Jc8zcZZ55nQtp7oS7XmplEIURcAuHyduEOMPMBCXuCAR5hwDZs ieDcI3i8PLmJIVLcEHNNxpZWb9IpfwXxZOEvoqpNSH/u9xifYuPVLWZYTUJmf7WCrkNezDzERmXSkps6QXa+dtOsQ7PXd Ze4SAH5+RvuwEenKpwaGSd+Yerev+IKnECYlI0BPsb4wPswUoK i1tXd/Q/COZE6pSl8LfE5RShZdv6OZkkGomFE/ZwuRD2YN1hrEIk2LxOUbAnRRthYqZNnlB8CavgRcekPZsp5oHB Pv+hDNOBSkkp1uecQyZSe9L8tR84TiNBNIJwSfwwOETTpdQA5e 7/MZKAGRHq59j+6N4mcEgEg58A9wdFdNQIokqF8lf2lLKZwD2UAS Oaf8mLBsjDtLHSF2Ow1a0KZmcZu7j2Qg2x2mmfdylCgHZO6SCM iW1HB4lzUWNlyqMEizdoe1ScDSsgLUygEPcPSyi1wBceYhWr7S 1qpC3lVS1MxG8tTJSpS1NQkO7BjYObxXNgFHdKKgCoqJdyFiwy UDqdC4ytAe15CJQBSCSp3Clg2tkKAAznrbhA/UuVHl5fd7hJtTbqpylTFkmYc1EqzAb9WgEeu/Z5iFSZeH7wKQMSh01qSxKbgpDOKnDAl96PI1yQiawClpUCboS9 muBezcI9V7O9klonYRU+ZOWFJMwIrBRLmSylaEqzORfdIvLILg xbim0zP+pKuLbosH2lyyrZ6xRU65b2cp3gygNS7DzjyjHYaXgh NWlSZM9NCTJKyZm+mtIIADlgFKaySSLR7ptckSFqSkrUgFSEpu SpIJRbI7zG/AR859ocCUzlSSg1SlK71Q3iTmpSlvcv0zL3jppXsTwRf/ACbaKt4YicxuGmFr34xuGn/wSTpNChoQSxGhBbKMhecRaAFKQF7oAAJKRmxaz8dM42lT7qQN8 gDjnbpC3EYjfd7adHf3QIhJBLaM3z5wtWFKj0rEbX+4YWSilKl LqTUS1JzKilrpBOpGY6QH2S2kZOISpZLLWO86qJ3lD9Tl3+jUD jpmIUyzUu4QSeGSR9axadghaJsozkLHdqStVSCN1BSXJOYCudo ErRpnk5vXS6PXMECkUhJz1YFiXzHAbo/tESTcWpOjDm5ZsrseXrEJxKmJoKgAGI4ksbB3tdwT6xyJ6iql2 6Fiwz3c2y1GcNYSkbVwafvSqyErUreUBu02JpDk35tccIY7NO4 VC7PdmvkPjCraOFRUplrlkOGUisAv+pJBItwh7IlUyUpzJa98g L53zOsSxQ9zZ6OHFwfkISlpaUjqfcPjHUpVCWYkk8jo+t/bG1Dh0Hlb3mJlYbJS1BCb55ngw841U3tFZNeQROLSSxYHm/8A7RMJiQ7UkjgST6BIbzMK9o7cEvckpA/eRveTwBs6csrJBL8YVySD+m2rHU2ceDciG9n+Ygmgguks/wBfKNz9qLAFQB5tf1EaE4KGTcCLiEtMK6Nicr9R0Pw05x0pIY/Wo+BMc92fLL1jtA042Pu+JjgEs3wgx5p2hl0TpqRYd4W6G/uIj0tReWOsefdt5bYr+5KFf9oT70mEa3ZD1C9tk+KkJQnDoSpN Rw6VKAIN1KWveYBiysjdgLmzLsQsd6yqS6CA5IDssjK7uR5tA2 HLKKwGADPqT8hEH3pUxRQh3AcpAsRqVF9LZuLnKAo27MEnUQJe ID0p3iNRUCwuzNawh9sbaGKR3S5KigyiqkEkpYipdjoQRu8gYr imXMAQaiAq6QRcXDDWwbLXpDjs/thSfwVVMpKwQbllXKQ90KJbws9uUUndWiEa6rZdNnfaO+DxIUs DErYSwglgksCQXLKBK1N08qfNmqQPEkDOolNzm5dyb8owbNQrE JAQalEMQogOz3FN+fxhziOzSlTUokhNaQFVKuzasxLcAxdvSU3 tG3Bmj6ecuUbf2V773hzcywTxADRkXCd9kgmKK1YyTUslRaSQH VcsAq1zlGQ/BfJX/Xf+cf6HnSZChmCGDh+TOwzZjnlaJJRrIYXZgEgB6TS1tTYvqSe MGbRmsuUFze9VSVLNyUlYYynOiQkW4qVxgLCJoQoEOqsAKB8IL lVmu7DUM3OGZ5fQ22SUJnSVlNIMxIYhqhUAsgGxbK2RfnHq2x8 VugMlVMpAsQagU1NSVOLM6Q+eUeb4PaSpuGOHnUCmYqamYogKL 1qWEWuXJWS4/Lyi8dhNqHFYNLupaDSsGzgeEn8pDWyzSYVlYsc7KxoopKie7NO e7T/yyXbMBuqTBZxAWHPhDNm7qfUjd0yGt+faZSXKykJJZJOVg5upJ HE8YDxE/dICiUryJ8bFvDdym1nAtARWKvSE0266VBJcsdWvdj6wyWliHsA B6m598RS8OKnAY2uSScgHAyD5xKqXqS3M5xSGj0MVpbNd+zUi4 118hkIAxs41MS6jnyHXiYKxE8JSTcD/ALlfIQokqqW5gTbNMY6sA2kN+DtiJ3jAm0xvwfsNNz9aQkSk/wAAvHynRAGCxNJY5e6HE9DohSrDwXpkov2jdCHyz9H88jEiWyU k/XL5Quwc0pNJy0eGSJmjtyVceRy90UTJyRIMKlSWSrV+foWin9s +zc6ZPlKRLKgEUqI0ZSjlmbHQRdJYH5kt0uPQ/AxNSfyq8v8A1VHNJkZ3KNM8Y2hMY90kEEWI1A4nm/tMBYZM2UXQe7req+8pBsQxfn6x7bjMOmaKZ0pEwfuDHyd28mhD tHsRhJhKh3slZ5lSPQ1EDoRHcV4ZjnikzyteJIupysA7zN0ItD lGAnTpi61K7xCApIXdZAZwhTmpgHblbWHO0/swmkhUidJm/tNSD71j3RBJ7O4zDhKJklbIU6VSyF08wUXHmBHSUqJQg8c+SIs BilJUlaVC12KQSXLAhTVA+Fr6ZWhnK2wZIfe7wtUUWK1IO6vO4 IYscmHWDMfgySFMaksHBKc3cFGWr2AvcvCrEYcgk+K7ksLGxHh voLOYyyQ2RuUrYf8A1yboZ7abi/dGoSHDK4L9VxkLx+xdla2uBWSgkpsHLAsQAN0cwrLRuMcSZlSS LOwPmjMf6ST6wfO7PzZk6ZLlJ7zuqiKBcp7yl7hzvH0fQQ82F2 BWxOIUEpUxoQQVOMnWRSksSLVRrJxxyn0hDhZS5ykywSA5G65U yqQrdHisTYaAx6rsHBHDShLSaCEhNCXWSQpSisuWSSVcY52Zsa XKDSkBL5kPUeqzvHo4HKGcmU1jbkP4+MLRrhhUe2aUtSrME8/Es9VnKOxh25c9fUxMnkGHE/TRGsjmo+yCXXwjUsZ0jzMQzDrmR+Y5DoNY6KrXvyySOpgHFTnD P8h0Hxhm6ReCF+0MQVLZ3AH0Y3gU3geb4z5QdgUwjNktQSFu1B vwx2EL+vuhbtC8yGmyLNzJgRWwZPxGdO7AolXgtKtI13cM0Zk9 Axw7raO0zblJzGh9h5dYmUPxBzaFPaSYZc5C02N/PK0c9DwXKVDrCrYsCU8jcfXUQWvK6bcU/TQkwW0KgDpwOXzEOZShncdMvZ/MElki0doVwV5K/m0dlPFPmPoiNhD6BXT+PlGqRo6frlHGciXh0Kz9of2iI/uQ0V6Kb2FoLudQrq3xYxpSDqn0f+YNHcmCTMAoi5J6gH3gwLM2 cGalAHAAp/2kQzFI/UPT+Iwr4LPmD/MBqwN/KEf9JR+gf65n/nGQ6v8AqHp/6xkdxR1oTpwjkvqSTkHJJJJbMuSbvmYlEtILZ9PnEx5+g+rRo5 jQHWAGzsJP9o9vziRCWyHn/EcpGoD8zlG38+mUcA7Afio+yOFF/kMvMxilf4HxgefN0DdNP5jikVbIp69Mxyy/nrAcyCFmB5gtAZoWkLc1K6w2wyGHlCuSHUesNplknpHFpvpCSc HXBeHUugUU1P8AmyDsTYZm+TgXvAqk5njb1gibhVGW0tVBqdxZ ybF20PrbpBijsjGqJmjjh8/j6xzgkrQ4mLrFVjkpjlVo72cZxqVIUJTKUK9VAa3Ysc8wfWBJG zCqSZc2laVOKWcEHzzLPbIiGozjuYN5B+s4S9sE+A81fCGuDw1 EpCQSQhgCouWyDnXSFna0biT+8+6Ol0Pgf+4hPs3E0k8NeXOLf gJ27w+tRFM2aHW3ERYdkzSN06Zf5iaZfOkx+FakeaYkSv8AcDy V/PziBCtbjpn5iJQX4H2H4QyPOaJCOKfR/wCY5ccx9ciI1S2ih0+hGxM/efMf5giGyv8Af6v8QY4J5pP+n+I6q5oPp/EcKB/SPI/zDANOeCfZ/wCUZEdH7R/q/mMjg0CpLCw8zEalAkNcjU5RwuY/PlHJvn6CEGSCgt+Z5ZR0VaewfEwI/wDgfExKFH+NP5gIKRIrLRvZEBRrrEhF44XfKC9FFohUmBpybQW oRBiDaANYvwKXUesH45W63EwHsobx6mCMabpfg8Eu/wAgRSMurxpE9aZ6UvukBWQtoAD1BOcESg/t+vZ7Y6VSgVqYhG8FagHPLPg19IKEkw2sDL0y4DLzEA7UxSkoE xBFvytY1M2rg34jOJMLNKwFLQUuXALEtzGhfr5RrDorqlTJYsx YmxTkCC7kaEH3G7om2MtnzCpCVENWEqIGQJpJa/E+2F/aoPJB/f8AAwylYinxBrMkBrD46ekBdokPh3HEGBLoOLU0VrZtpifP3RY ShlA8YQYSyknmItCZbp6RI0ZHsMwuIexz06cj8ILBfgfYfr1hY Ea+o4fxBUucesGzLKPlBbt+pP15Ruv9wPUfFogRN4OOhf2R13v MeaYayLRIr+1J6H+YgmD9ntjFKfRPq3xjhSOQ9f5gWdRjDgn/AFfzGQEufMBLSXD51D5xkDkjq+zhH00C4mct1BNVKbkgAgBnzp NJzO9Y2ugXUQJkBYlitWT2IcSyQwTvCohWYyQCxTa5aGj2Tyt1 oZJyHwyjt4iQbDSwtw5RilwC6JFL0jh2jhJjoqhTrNmBsSLRMT aB8WrdgjR7B9jjPqqCsTKc9Q3sgfZIt6wdMS5NoYvJ7IUp8NrW B6vrrAk+d+GHDkKDsWDBQUEc1GlmGcSrxbMSBZyS7lg9xa/10iFEsEqUCpQVSUuCQkPYhy1uAyYZ2gpWSYX/AFGpMygArQl0XBCxekZgAuLjOIRja5koKYUhdSgkpSqqwFK97N ieYEcTsIZt6igpUbBQNQzBLZW98ZN3rlIKkpskgi5fdryPll5w 37C0MFYm6kuCwD5Pytp6aRxid+WpN2IcA8mgTDo3UldlKzBL8q XN/wDEMcMoKCmYsGt0y9G9YnvyMnRVUhh0i2YRTpB4j3/59kV/GYelR5w92YNxPQQppybVhjMevv8A5jZk8Le7yjZFo7QqOozM4S ePt+cdKV194jt/r+I0E/X8RxNs4Ssft9I7kzElyCC3CKn2m7UUgypJ3rhSv06MDxzvp1yq eF2rMlmyj6wkn4Q3C0emzMQtyzM5beTGRRU9sZjZD/Sj5RkR4sXgy2NAk7xEGwLaOck3ANiQ2aQVAVeEF4reD7Xrlmmc mpiz2Crcsj7IfydsypiQzkKsxAvdIZlHipI4Elg5tGuP0Smk12 MUrtx+MYTGhy8o2BAKHaDG+UaEdiOoBoiBsblBSoGxGUEaL2R7 MDW+s4IxqiBrmPO/h84GkpKFBw3LW8T7QmmpAF7KLc2IHxh0rLJ2wFMs1VVGkBikAk 8CGFvMRCZlJWVVhKVhCES1UhiKiWtzzg2RiCaSoOCWcZAlwHGZ GV+cZMkATCVUsc3DizgKvkbkekOc+waZVSooBWGBQVJBd8wcnb m2ojJM1yWWpSkiplU0qYAlLJAY5i3DWCvu9xuhLcLAO7hrWPpG l4a26A4/MCQPTXpCrsFg81IQlNAKqi7qbNV+DA5ekMsBiQTSPM87khvb5x xJwgSlIqOVwS+QYNoOMSYcCuzgNxclrhzrmY5x8nM4x2HcPE+D Nh0EQYyYRKU/NrgZAkXOp4cTAeydsIKWulmOZU4OZFrNwiT7BLJXtZYRGjAx2j LTS6gKg6ebahsxGl41wCgBT6VAEfXSOZKU0u2Fd42f8wJtGZWm ZLChVQrKxdrX9OkaxYsFBLrLM+mp5OOPOFuMxiJSTURUQQdc89 7j6wrZllld6PPVqjVcETtkTCo0ZAOK0qTVxFRDAj2wCZjFlApP PXocjE6NUcsWSxkcvGRxQse09jSVAlV3Lu1zr8oFk7JKEFCJmI lBRUppa10lksqqUGdkm6kuwUHSbQxxOLUtfdyQCvNStE8yflnH KJfdqAVPQou5CqbHdIWhFKt4GplVJUGYF1AHRFHkyQt2TNxAmK QmaqiWkFRVdhoAli5bgNIZYrtJNRMCWYBBUrvEFJ4DIj6MF4DC S5aVTZJZJACiVON18irQcXvpAeLw0oqXP7uepCvFoGcGoFRqpt/iFNCyS6HcvFTFS3ApVRUCRZ2e4qcRHsra1aEmYWJvy9IGXPSmS F1ASSGShySpOoAJd/PzaIDjcL3gATLMspJP4a6n0AIF/wCM44HOTLAgkkUkKT1+mjub4bADMFSupAABiuBYlTZapClGXMc U3dJtxv5HnFgliwfMD0fNvnDRi5aB7nqzRADannx+tDGpk5w5s Rk2kczJwgYoe5NukWcUjVjb6ROidWoBR3QQbBna4u8TquSzl2d s9YglTNEj1zMbVLUDUktyEdVIrbT2FTWAzTwtm3N9I3hU3Fxm3 lpaEk6etKqruc31grD7UCsx5j5QqkmH9hpMDEggKcuL+yODOpc 66NcDz1MQS1IVkYkKHh6sVsgRvLch4Cl7OGHXXWsJ0YEsDdlMD u84c4TCG5Y5Z+kEzcFujUgbwvk7jzuYm4WSaUlsrs2lbTJxBlp ek1N4mbwZ5e+IVLw1ShUEANSuXMWSXezF7hhxzhl/TUoQUrSFhRUQQEil9BwI484D/oEkCWQUllfiVzG3b1OAbKHLhEq8GWqdEKdrrlqCSvvZahurGfQ 8Fe+BtmYkIM6YpJUtIFKRc08Rwc68oK2klExcuXIG5LJJIyfQD ic/WCp/Z1SqVy1GXMSLHS+YPEPp0gdMXyV0doVlK0iWVd4slNSlKIGdLA aMcmaCsVIlz5IIQsIJ/ECQ5IGYQ5tvZkB7GGc8zNzvpKqkEsuUsDOx3VhmPBzGfeRMnJl lBlhYLEqBdQu1KbPnrADaKv8AccJotYGgc25XTGRdzjpKd0zUO LHPMWMZAth5Mr2xsMmfLmIehVZqAAuNHe511jWH7MJUZgFSaLJ qlpZRbxZXS+gv6wXP2LLX+IhRSXszhT6AFOcCCSo4iVKXNmMpR qClqY0h6LccooIpB0nBpXK7hFVxdRZkkXegWZ9Ocdqw0xYUkrl OBvlFRUzflqsh730jnbU6mXO/CsAGmBQSC7AWBckE5ZFoV9npB3lpQlZQEpAKqWJDkixEdQyGaZ MucES2KAnUKFwLM+Ze19Ih/p0iXMmGaEhG6EJKypRN6iEpJN7W90cbXHeTJMogKWkFSwnIEgW vzD+kONndn0ywFUpc5N9ZwYRb0FJnGDw9ShMUmgJDS0N4AcyQM lHhoPOC1vBAl8bRtcuNiikqRaKoCVLf/EZmGGkFnDk5XiIpYh359NYHCy0HTIkYUkBYsHI5Pb3h4nXhS1T t0grZswIUUqZSFseRBuDHO0tnd0p80HI8ORjnDWjr91CjEBxm/lEmF2YJpFr8QzjrBCcOPKJsMikhQ0hViC38CPGYSYhZSdIjQJw yWYuO0pAmBM0a2V1+vfEUjAB4ZQSCsloT7PmYlRCK2qzIABbrD vZqHBYFgWD5q4qPXhDPZ+BSnfWRZ7RvCSAlJt4i45Q9WTllTtC vESFBK+7pqa1XhByDtFc2xh0/e2ZJKkVKsDcFn8w0Wzb8wokGhQSpRSASH1c2OdgYQbNwspCq1L K1quSWc8Hc+yMuZVIzTdnQSJSWtU2Y8QfkfhG8LNpZ1OpWVz5j 61aCcVOklYUoF/YeGUDY0I8dCnNwXs/VogSqiOZNVLUUhRN7Al+l4jxeFlzBQolK8wo23s3fQvkYxEp99 aSQeJ8hDSUJfdVNYabp6aQEgJiZsYLVpLamWkk8yXuYyGycbLb Jfr/MZDB5CKQsgO9xMCRyTwHKFHaoMSRYhSSCMwbXEbjI5AQ42f8Aj 4Ud7v1C+jt0yygXaizIwjytwliSAHdWZc6xkZDvsr5Jex2GSU1 kOpTuS5JyveH2GLLbR8oyMiuMeBOoMY5npZVo3GRoHRihEOLz/wCk+6MjIKKR7IZI/Cl8qh5C4Hth9g014dQVcAGMjIYXL3/IowIdN+ME0hsoyMgDS7DNnB0zAcqcogUpmPIRkZCsWHbCNnqKi oqvSLf4hkqMjIdE8n5CjtFhkrl7wdha51KQcuUUntHhxImjunS/MkeiiYyMjDl/Nk2OMBvSyFXYP7IIw11ISfCQ7aPf6aNxkQ8k/gPxEhISwAZyG6gn3gekYUipFh4dLZZZRkZDo59EasIh/CI1GRkMcf/Z http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wBDAAkGBwgHBgkIBwgKCgkLDRYPDQwMDRsUFRAWIB0iIiAdHx 8kKDQsJCYxJx8fLT0tMTU3Ojo6Iys/RD84QzQ5Ojf/2wBDAQoKCg0MDRoPDxo3JR8lNzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nz c3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzf/wAARCAChAHkDASIAAhEBAxEB/8QAHAAAAgIDAQEAAAAAAAAAAAAABAUDBgACBwEI/8QARhAAAgEDAgMEBwUDCQcFAAAAAQIDAAQREiEFMUETUWGBBhQ icZGhsSMywdHwQlJTBxUkM2KSk5ThFlRygqLS8TZzssLi/8QAGAEAAwEBAAAAAAAAAAAAAAAAAQIDAAT/xAAlEQACAgIDAAEEAwEAAAAAAAAAAQIRAyESMUEyBBNRYSJCcY H/2gAMAwEAAhEDEQA/AGVjcQScET1iyR5ktOxEkU+mV1GAMoRpJ+FJ5bZZRlO0Vio9l4 XQ/FdQ+dXOG0jufRPhrTLbP2Mbqq3Hsvq1HAzv08OlIry0aMZjgu4/YP3WV18iSTXHLTKIol1IouVTXFqK7YA/6cVHdHTpOcAH8KccciVLp1VhgdBEVXpy+tKLsZUdd6Wbuhoi1V eSQMc62216sEe6j2AYEHlyI76EQHUusMBnO+9e+tt661sYxjmG Bzt/5zWjbM9EFnC6XchXKoowATn4eFMQDpB1HlWlqYYoJ7y8SVk1CN RFgEsd8ZPgKYcOl4dfQExREOmzI8h1Dx26fjTKDmDlxFLSuGY5 GnkNt69SZidhnzo+94biMvakkdUO58qXRrgknIHeaEsbj2ZSsK ilV+WduYIohTyFAwMHYuNwRsaX3rt68VBbGehqXG3Q1liQ5Gal XNVH1i5UsouGAHLcH8K29YmZsG5kO3IHH0Fb7f7Gplur3bvFUt i7adU0xLHlrb8620Dub5/nW4Jem4s+juD28j+jFtbdrImZGQpo7VPadticZx15iq5xBop7q XsI7ZUywAtrkr3DkAMVpZcUl4cnZRCWEq3aabeQFBt3HG/PbFBXF5byHHrEUy6cZltyMnbO5x1z0qs3ZOIm48X7Ukm5OQBk6 e7l/rSG4/Y65YCnHGGWQqy9mV0jcXDEfTb3UmnOyHb7w5UrXQfRLfXksNyw IdgPZKk4AGOYx+t68itmF27KzBcGQg+Yxk/Gi7q1aW/jeNkGANeRv5UxtrVbqVLY7LK+lsdF5sfgDVL/AAD/AEYWNt2PDLdLxAwkxIUYd+eY67YpmfV7O7jea3ijZiCz+z9zx3 6YO1ZxsTevWwVAIyCGcA5TkOXXl8jS65snvpIj+woI2HtZI6eF GUeLoKXJWje70qsTxkEDIBU8xz+lCcQsRNaetwjLDZ01fe8aMs rB14fcxSzCV7fDRhhtp5Y9/PFEcM3n7HI0umNl1Y5/rPnXQo8o/oi9Mq1suCRjA7u6lN62L7O33iKsl7Zmzu3QDKMSUP4VV78/03bOzHeuXjUtlU9HsDTyPIjSFXUEgCNcHzxU3C2muhIsk8gdCc 4WMDy2ocCQ7pcDfp2+Plmt+znbczP/AJgj8aPlAfdmXj8QicCF52H9mPP0FD9vxbvu/wDBP/bRPYSk7yt53BP/ANq97B/4qf5j/wDVFSSVGo6omLuMRRxWZw5XKSaCNvAct6n4jawWi2q2z3Yl7IG Uew2kkA89++lMc+ZpVeePcA/aQkjcHxrcaCRoW3b2f2ZiO7pioSdMddCfi3ZqykMinYkyQ4OaX XG653592OtMuKZBj++oIxs2vPOl02ezOrUG6hudOvigPsDQkTa jzzvVl9F7aS4uZ5I1BKoIkyCfabnsPAfOqnaTMbtu1YKh2042z XTvRuxW2sbXUi62XtnVzgFjjn7hjbwq+OGxHLRDxJWmtYicNKg ZsjqdTdO6lduXSPtFQjfBYE7HofhVkuFHrCkyamC4bXnJbUe88/hzqtX1tJb8SMCOTDJh4lJ2wenkdqfLG9hxyrQSsCfzVJIrDXLI F58gM7mpOGWrKZJmV0RV0qygnBOO4HJx08fOpzMYLL1eDUHORK c7YB5fnTDhUKvBE5UvGAz+zzHiw328cDlVYtJUictuyu39qZ7V wB7aHUvfkdPOuc3ak3ecDnXV+UesMX1HS5ZeZznI7+njXOePWv qfHZYigCSfaRHvU/65pMsP7IMX4L41hEfZvJEMMeYOB79t6jnhtmuFkWS1Cjnrxj4f 61trh7coz7l840sPoK3Z4T2g7aIM+wBkII+I2qG7KS2qZC8MUl 2JO2thEBsryA48hyo7Xw79+y+A/OoNVuS4WaLOnAHajnWmlP40f+YSlkuXZlJpUjoMUrJdAtJdKGX 7wC5PPpit1vFYhe2jYjO0kBJ59d6D7PVcxkwPnSecpz9fxreOM B2ZYpwd+Tg9fE1KSVjLoDvpUaVQrRFhnIjUoefXeg3+44PPfYH JFT3YYMDplGScg6TnBoZiezIA2G+wwBn61VL+Ir7NOG8NM/EoYX0uJXAB6jJ3+VdUsoFlZ2LhCHGk4zpA6/KqN6Gxes8aXI/qY2cHu6fQmulwRIbNkhOXYEFsbKp68vD6V041asnLQqNsNcmSC qqMMufaJUHPLpkUBPGnbxzSIXaM5AA/HnnlimVvFIB2crjswuosBkjkMn3D60NxeOWSBJLRAWi3Crvlcc x47CqNaAtsTXMZMxPZ4B6HkaecLuGS2eIxksx0gghcbYGSfP49 KUQ8UAdWuIAxTYlMAkA+OabWaRXcSuFljRvu5Qe0fLpz6UmNxk 9BkmuzeRI5JJO1Ye0dQSMeyp+O9VD06sfWbOK8VcSWrEZX9w8x 9D5Grg1tMmQh1jSGwBnbJ+HKhOJ2yz2k1vOpCyKcgjltjPP31Z q1QidOzi5CR3KSdqwCnkUP1qWB4lvzcSXEWg/29/mKK4vYtbTvHIURlOkktgeVAxRyOMJlsfuuCK5JRp7LNqbshuIU e8eVLi10sf4q/kK07BP4tr/iLRRguOXZSfAGtuwn/hSf3aDmVhJxVF1YHtYn7FB4yyHVuPcfrWRP7b6hCNzynb8qFmK RNGSbdWDjf77c/LNV30keQXds8TnK690Up1HWp8OToROkPbt1DKcQ5yTtKSfpQ5Z uzyVJ6A6sjyqsSzySqdc0jZOyk8jW0EhTALYwc5z8qpGNIm9s6 V6AqVkvZ1xklYQT7sn6iugNJmA2kRBfODltXht3Hr8ao38n1oy +j0DnUHuJGmXPRc4X5DNXg5TEbaRIFUe0OncPrz7q6YKkIyK5k ijhmuZG0nBZTy1EnzPXFAcMl9bslMLOLiLAMWAuDjp+t96n4xw uS8ULA2l7dS655eIOBk8/E9/dXnovw1orRr1plV5YxgE5MaBhuSd9zv5UW90AkNtaSos95bxLO xw2rbB93UUTNaq88f2g7P8A4uZzWl9Y3bzBgpbUhAGnPjnw6Hx ry0iktsRzNpZc7EZwd/Z670Ft0ZtiO341HJx+S1VsRNIIllJGNQJySc8t9vPlzpxK8c0K McK+d9gQfIVWl4GYvSYLCQtumLhVwSVIK5GcctRzv02qwSsoZ1 ZSMSEaTt1IJHu5U6EKJ6b8NZGF3CC+o9k6rsc9CMd/KuaX0DpIzPE6Y/fWvoWWG3CdpINhggZyQff3fOqNx30VteIX7XMF+0DyH7XAJVic YIGduVLNelYyqNHPOE20TRPJIik9H1k/IVLiP+K39xvzq5p6EtFAJIr24kkLKo9hFxnvyCehoj/Yu7/3u4+EX/bXJNS5dl8ckl0JpJ2ckRsTGd/Zxt7vlSXj6v2cc3t6Vf2tTA4zUdzcXknNhGpbIAXO/voWaKSVdMsue4MAKdUmT4sHVdSav2ieYr1JMgkgnC5x3msW2VD gyZHXFMvRrh8XEPSLh9iSSrzAuD+6uWYeYGKZAcTt/o1w71DgdoGxoggjU5OM+zy8zuffW1wzS9rM4ydakHcbnOcd3IC vL+/RGXh4kxI/toM43/d8x41DayB7UDQAdXIty+fv+NWi0I0x/ZXSh2bXrJI1SOoOk8xzIyfHpvWvCrpV7WKRGcIcaTzKbn4ZIG3 dSYzOL2eMPIFdR90+P+pre4AhiE8DORGftCQD7PPIG/LemoBZo5G0aVywCbBW/wCYg+Q3oS6Kdu7lGIBYnLb7AYB3z3/GtfR/XJIHaRZYjucLsNic/TY1DfQOy57fLsWTSowNju7HPLl5isBiZlaW4uJ4gCqHOnrpB3x 8h5V5xCZfWJk0BAWIwQcEDGNunM1HxqEWtvCkTBAznOkkFlOee +/0rydzN2TMmF1IDgjB9kD570RQW5nkdgZQF0cgNtqwTPbbxK0R5 E6sAqRnAPMn3e6vSwikYOuQuThhnfuqWecCGKQ5kYEhS22PH9c 6VxsdS0a8dbVZMjSYbdmcAH7q7HY7jH061zn+fZv3Lj/DH5VcPSm6S34JNKzaHdOzLkFjqY46Dpn5Vzn+i/73B8DXPmTTVIeO+2AzapBhXOBzyaiL4OkE7Dl1re2gvGXMUTOp 6nkPjUn80XLMWd41J8c0UO6XoLIwXGKuX8ltsknGLq9YD+iwYU +LZ39+FI86rcfCF5zSs3gu1XT0Cgh4fw68mmSVRdTaQBu3ZoCM jO25Lb011sXUtIZcWll9fM+SzEggjcFtuVXQQIIkCsExGXY75y WHQbc/x8KqcNxEtxardjEhkLFTt1wPDA8O/wAKs0GoNJlwBkBsAnV1x9OdDBGk2Nlkm0j0ALNcOOSRnGTkfrn UUF2BCY5CWjfmBvnyNGRQ+sXFzbMmNZKvvsMZyPGgJOGzQgOB2 1uSoV0YIxBJBJU9Ks2/CKGdjxCxtJJZcmJpFA7NdlY6T099bXXGILOygFvCrPISzEvgli TjJO5Aznu6Uhe0DzRJGLhJGyAksJPmABuMUdPacPs3KXDz3LAF W1R6IwTyAGc9R4VNuQaQjvLq64leG7kH2SZBYLgKP0eXhTaVQb e3aMkggHGnGf1+s1LLZ3EsiesQ+rwDSyWykEFgxIIP4fGo5yQs eI1RQdaAHmCTnbp3VWKpCSAb8r2zsh9nLFcHBx4Uo4j6SwcKvh a30MnZmESGQLrC89sDlnv+VNbtg87k8tRz161QvS64SXitzGzK XjhVdOrP7OfxrSAhl6S8XsuJ2UMdlI7faEyBkIyMHGD5/Kqx6nD+4/xryxwbWElskjfei9Pv+JrmnFt2yiyUe2e0RHLSxFbvQX84w2wb Vkl2JXAzmoH4tJIrdlCQcbFqb0UMuG9qGHX2ZnkWPV+7kgE+Wa vfDeEeutbwwKIYY1SNQ5yVXIHxwR765RcG7uQC5yQfZVR1rs/BojawtHO7TOAzdocbDIPLrt9aKjyeykJcU67AbVY7bjnZ6m0lQ ya8kglBvnyO3j062GAFLeTWQAXVANQ/P9Yqs3x0+kcRRnDC2DEk4Cn2hkfAU9tn9ZnEjZ0GZSQBzXGMdP f8+tPDVoEm3tjuyIdLqSQe28m7ciBuT4Z2x50bHao0KSOcgrlg u+kcsDx3NLISq2yhWGDqPdzOPpTuASSWsA9pW1qvLl0H0+tUFB pFlLQOGYZGAcYIGwz345bVHfLPdRW7BocGdSZGiGogcxnmO/uo68zqt0ZVKnJTSxJwd8MB+FbcMSe3YtoViWO8Z9k5XkRjvx50 stmMK20TskedK51sO/uHU9fjVb40dKRgEGMKMYbx693P5U2S6PaTsoPsRaWGPZbGxI6Y z+u9FfStLHpJHTGTTIRiq6PZyuoJAH5Z5Vy/0wRpvSe/dRkBkUHvwij8K6dfHXclc5yFzv3gY9+1UDi323E7uRhnVM3Xx2 +lSzS4oeCsq4hlVsqXU+BrOxn/AIsn96nfYqele9h/ZFc/3WPxAkiQKq4+7sM1KEzjapViw3PNTpHtsKZyMomcMszPxKyjH7 VxGT7gwJ+QNdTgZQDkMScnn7yevgaoPo5CDxq2Y/sh2/6TV2mieWERqWVpGwuDgcjnfvORVcb1Zmt0KL24j/2qWALlhaaDnnnLEA+OPrVjtCEmdwSV1ofaGDyXfYdfqa5pxLtb D0knBVg4uWMeSSXQn2d+vs4ro/DponbXbdm0e2k4wCcDIx781scrsfNBRqvwM4AdMY/eAJx0A606ilKwI2dBjlVgQM5wRnbv/KkSYWdQAAAPfimMUyLGCzErkeyT17+VWIDficKxPaIB9pKS7tk k5xt7utQ8LV2Z+ybS2rS7b4C43PwJxvzxUXF7zPEeHxL+3pjcO cclJOPPG9CPexw281pGp1Tn7Zh0TH3RjkSdvjS+GAvW1eV5URl iDFI4hjZB/wCcnxpbcmRX++QFynPoOlSQsWWUhizl9jy76DmbUWwuW1DGDyF UFA7g6bnIU4BBxk71QZFkaR3x95ifia6BO2DIwjLroyd+XOqeY 8743rk+ofRXGLhG3dXvZHx+FHiLflWaPdXKVA44NI28s1OkeAd qmERqRYyBn4UbNRLweWK0v0luCcBCoIGdztvVmtuKQ3PFOxhVh oUhXbk2OuOnOquEAODTf0eUNxIYYByAq5ONy1VxTdqIsl6H8Ui M/EBdSlZNSPnVjYk5yM+dF28UdsJI4lCDYkg53Kgnnv4VFfnSzLn ONQyff1qRjgY66V3OOWkY5AchgeVdXpPwYwydo3aPkt17s0VIx 1IxBILnYHx6/Gldu+Mb5HdmvLiQhgQ2MHYd1UFH15Fc3HFuHGGGR4kVvtEQ4TY BQTvvvyoC6iMF00cwkPtZkZ105bbA8qGj4jex8XhijvbiONoMt GjnTqwTnGedaPdyzTNJPLJIxz/WNnPduf1tSozJLZj2cxLAajg++obm11KexmWRiQdCgjJyOvnjN aW7MEbODk4xS64tUR20F13LMNZOfDfl37UmVZNODKYVit/cb/4G3tkxtZ2R43kWJiYlc6gBz99VyLg9/LEjx2+UcAqdajny5nbpRdzEkQZ42ZWYb+22/wA6AMkqvqSRw3PIPI+7lXBmWddtM64L6VvTdf4Q3NtJazPDONE iHDAEHHwqHFTyAsxd3LOd2Y8ya1yO8/Cgk62RnSk1F2jVPwFb91ZWUTHi8vL86juf65f+CsrKMPkjPoef ve8/Wmjfe8vwFZWV3L5EfCSDmP10rLr7x99ZWVVdCESf+oYf/aP/AMDWw5eZrKylh6aXZtD/AFf/ADUNdcz51lZTiPsX3/3V91ANyPurKyuPP8i8OiJvwqOsrKgx2f/Z
https://encrypted-tbn0.google.com/images?q=tbn:ANd9GcSKgT_7oAGhnnqZqzR6KF58in6tWuNaA HWBCEoCZs_EYLismn5G
و له عدة اشكال وقد تم تطوريه و اصبح يخيط بعدة اشكال ويضاف اليه العقاش يكون روعة ومبلغ خياطة الفستان الواحد 6000 دينار
اما الرجال فلباسهم سروال عربي وجيلية و في وقت البرد يديرو قشابية وبري او من الصوف و هناك ايضا البرنوس ..
http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wCEAAkGBhQSEBQUEhQVFBUUFBUWFhUUFBQUFRUUFRQXFBUUFB UXHCYeFxkjGRQUHy8gIycpLCwsFR4xNTAqNSYrLCkBCQoKDgwO Gg8PGCkcHB8qLCkvLCksLCwpKSksKSksLCwsKSwsLCkpLCkpKS wpLCksKSkpLCkpLCksLCwsLCwpLP/AABEIAQMAwgMBIgACEQEDEQH/xAAcAAABBQEBAQAAAAAAAAAAAAAAAgMEBgcBBQj/xAA/EAABAwEEBgcECAcBAQEAAAABAAIRAwQSITEFBkFRYXEHIoGRob HBEyNS8BQyM0JicrLRJHOCksLh8WNTQ//EABkBAAIDAQAAAAAAAAAAAAAAAAAEAQIDBf/EACMRAAICAQQDAQEBAQAAAAAAAAABAhEDBBIhMTIzQSJxE1H/2gAMAwEAAhEDEQA/ANxQhCABCEIAEJi1WxtMS4rwqunnPPUwHiobSJSbLHK6q3SqOz JfO+8VMZpB7TJN4bQRB7wq70W2M9hCQyoCARtEpauUBCEIAEIQ gAQkVqoaCTkFW7TrC57iKeA37SobolKyzSuqu2ao7O86eZUxtq ePvTzWf+iRbYz1kKPZrWH8DuT60Tvoq1R1CEKSAQhCABCEIAEI QgAXCV1ccMEAU/TFpL6pBOAS6NZtNl5xDWgSXHcOKiaaHs3vJyxPdj6KkaR0w+0v NNwhjYhuckgGXb+Swyz2jOHG59FttGuIfhQiB944k9mxGidbWv qClULbxyIIz3EbFS6VB1N8bSDk0CO5JstlLPeZ3TeGDRBGOYEp L/R3dj3+C21RsuiK+be1vLaF6i8PV2yOuNqvwL2Ahu68AcV7YXSh 0cqfZ1CEKxUEIQgDydY3H2OHaq3StjKNO8/ADvJ3BXG32a/Tc3eFk2uFB15jDkC7AnC9vKyy9Wa4lbo9apra+9IDWt3GZ7TK9 bQ2tdOsbpwdsxkHl+yzylQL6QBzBw5DdKl2eiWtzk7wLvLLbxS G9x+2dN4E11RqbakEOafncvXoVrzQd6zTVTSlSuQHmbrZLoggh 0YxgVo1gp3abRwnvTeF2zn5obOyShCEyLghCEACEIQAIQhAAhC S5yAPA1mpNw3n5xWV6Rsf0e2uAPVcA9nDYR2QrvrxrTTpuut67 xsBy4uOzks1tIqWh0zLxJbO0TJaOG1LZZRf5G8ClHknaPplxL3 1HbYugEY7M1yw2d4r+za9zr7mtDTnLnAA8F4dntVSnLXNdyyCs WpdR9Ks61Op3ywC6xxMwcC5p+IDLml9nPI1LJ+eFybm0JSrug9 ebNaXXGOLH/DUF0ngDkVYQ5PxafRy2muzqEIViAQhCABZb0gdSoHRMOOHEjDy WpKp676BFek7ZIz3EZFVnHcqLwltkmZZQtVSBkYnATvUq0W+ae 4leM+s+m4tOYwvA4HiDtC9fV7QL6wv1JbRBz2uPws/dIvF9Oms9InaC0q2zsmoH3S4RczcBJLZmIVoHSyyfsHRxe2e6F W9O2toik0CGxhsbGQC8R1EEEgwojPYUeNZP00ajojpLs1eo2mQ +m5xAbeAIJOAEg4dqtwKwzVbRZrWyiNl9rjG5pvHyW5hN4puSE ssFB0dQhC2MQQhCABCFwoAatFqawEuIAG0rOta9ffaNdTsxIBE e0Bg8bgjxKX0j6cGFEOxcfqj4AcSeEwFQmDIcwlc2VrhDeDEpL cyNUa6cyZkm9iZ3ztT9jqwZEgiDyIyKW8JAZjO5J3Y9tL3ZrDT tdKnUwa8/XLdpGYhKtdnawXWCA0HtJ2leBqzpc0qlzNrycD6KbrHpMBrgLw L5GAyC23rbYrKMt234VivWHtCWE57Mp3jtVs0H0h16UNq++bvc YfE/Ft7VT6dCO5PBuIWKnKLtDLxxkqaN30dpBtam2owy1wkb+IO4gq Ust1A0o4WltN1VzWXX3aeFx73RIdOR6sjt3rUQuljnvjZy8kNk qOoQhaGZwlUHX3WQOH0ek6Xuwdd+6D9aTsMKXr7rMaLLlMw52E 7RvKzjRALq4zMnE555yVhknXCN8eO1uZabBq7SN2o8EhoDbmww PnuSdYNOXcGwIwa0ZNHxH0UnS+lW0afg1oz+eKo9a0X3Fwkzji lpzvhDWON8sctDwYIJJP1p+JDaRacR2EJLWb0vNZ1SGrPd1O0g 2ha2PODXdR87A7AHvAWvgrBGVCHRGBGc7dy13UzTHt7M2TL2dR 2/D6ru0R3FMYJc7WJaqHUkWBCEJwRBCEIAE1aXQ08k6oWlqkUnck AZFrk69aJ+FsTtkm9Hd5rxgcBzUvTdUutNQ/iu/2iFA3cwuXklcmdXFGoodISg1KASmBZG4zBBwzGI5hSdLWttRzY a4ANEkiASfh3jZKbcmyOq0nLEcgDOXaiyHG3YFpwj/idueCU1ONUFiLQrlrw4Zt6w4EZHmtq1Y0yLVZmVPvRDxueMHfv 2hYk9ucbT4TktK6Kz7iqNvtGnvb/AKTWnlUqEtTG42XlNWirdaTuCdVe1w0wKNB05xgN52BPt0rEEr 4Mw1st5q2lxzDeqOe3x8kxoauKYfUJADbuB254DjkoL3ySTtJJ 5nFNkYePM70g3bs6ShUUh60Wp1V5c7/nAbgutZHPySLLiJUgCFRs2iuBJSohJG9dB6wBVSRUeXmrNqTpM We13XOllUXJGV44sJ7cO1Vs5E70mlUxw5g8VKlTsicVJU/pvYK6oWibX7WhTqfHTa7tIx8VNXTTtWcboEIQpAF5unvsivSUH TAmk5AGJW5vv6wP/wBHeOKjBsKdprC01RxB72hRMwVyZ+TOvj5ihbnwF2gfFMg5LtN 8lUNUPPCYA6pwydnsjd3qTKZa09YDIgT2HDzUEj1PJLe+AuMUa 2vyG9CBiWCcVe+i2r7yq3ewHudHqqSxmGOHAK3dHL4tZG+k7wI W2J/tC+ZXjZpxOCyLpA0oale5OAxjiZA8B4rWbU6GO5FYhrO+9aX8I HaB/tPZnURHArkedE/PBdpNn52JA+eakMbASLOkhTUlzpSnHYEXIVSw258ZZ/OSjipDgeakFoTNRs4q6KSJVSrIwwXaAkg7lGpGcNqm0wAqvgsn ZpPR7pgPpGgfrUpI4scZ8CY7Qrgsk1QtDm22ld+8S0je0jH9+x a0E7p5boc/Dm6iG2fH06hCEwLgoukWTTdyUpcc2QgDDNaaJbapOAcBB5YH0U FuJVs6SKDWt438OEgz5Kl0KuErmZ41NnU08rgTTQBGPeEhtmI4 rtOsEsVDwHisRgUDgnrFTkVOFMnuIKZu8fBKs9W62rwp+ZAUA+ jl7BMBl507E5SEjelOmckdAcxVw6NrGTaHP+Bh73GPQqozK1PU PRvsrIHH61Xrnlkzwx7Vtgi5T/gvqZbYV/0n6x29tKg4udd+dixG3vvOe4fecT2Eyrd0kvcXC8Tg4gDZv8lX tG2ljKMFocX3s8twJTWSVun8F8MaVrtkOi1PBca1OtalGPpHGs XGt4lLJwSXFVJGnu/6myNyfDeCarVYwCuishFLMqXSlQ6VKIKl0X45IkQui19H1nvWu fgY49pho8ytPCo3RpZcKzzvawdgJPmFek5p1UP6c7Uu8jBCEJg XBcccF1JfkUAZF0kVCXsH4nnuAHqqdQfjIxBMRw4K2dIT/es/r8wqvZafWG6PRc7N5s6eDwQ80TiE8CowBnD54pxj5S4zZID5Ul ujHvAOTTBykn9go1Cq0PEiR67ivcGkAR+2Co2XirGdHUhTmKbH tJxa8T2g5helpfRlL6OKtMNYYlwBN0ieJMFeLabVndkbyP2UG3 aRc+k1kXWsGIEkvcSZcf2WkJqmmZZIO1tHXnDDbl2radC2gVLP Se3AOpsIG7qjDsyWGWYGBOGBgc1rnR9aC6xNB+497eybw/V4LfSupUK6tXFM8LpJsBcxxAyh3YM/ArO7K4XQNomeUyt70jo1tVsO71letmr9OzvlgglxBAyymQNiYz R4sx08+Ujw2hLJSLyHfMpI6Z2o5JCSWjaF0UxsQQD34blGqHDB S/YZJFpZkrJlWjlJ0wnWtxHNMUzB+clIjieQUMDTujmoDZnjaKpn ta0hWxVHo3sJZZnPP/6Pkcmi7PfPcrcuhi8EcrN5sEIQtTIEiqeqeSWm7QeqeSAMb19f 79v5XeJ/0q/Y/QeK9rXgzaR+Q/qK8azDFczN5s6mDwQqlmk2hsYjuS2/WXXNlwWJuRqLCc5x7MdqmU3kHeNxTYO38XqpHs8J4x4SoLWBE5 7EtchdAVSTlXYtK6NHfwzxuqnxa1ZtUWjdGP2FX+b/AIhMabzQpqvAuRWX9INT3o/M7wAC1ArKekD7cc3eifzeDE8HmitBBCHFdAXOOqIK5cSnIBQAN cV2o6c8Eq8goIY5VsDmNBcOqYh7SC08JGR4FO6PsBe9rG4l5AH aVFaDdLTN0xI2dysHR9QAtzNouvIB2G7mPFHEmkUk3GLZqdhsg pU2MbkxoaOwQpC4urqpVwcfsEIQpAE1aPqHknU3aB1DyQBi2uo/iR+T/IrxKTvNe7rs2LQ38v8AkV4IyC5ebzZ1cHghx2adpjamn4wU6w4 LJm5HY7D+r1U69s4z25Lz6G3mpzT5KGCHCgIlJJUEnX5LROjA+ 5q/zB+lZ1UPVK0Pou+xrfzG/pW+m9gtqvWXYrJde64NoAGy8e8x6LVrS+GE8CsV1hrXrW/hA9T5p3O6iJ6ZfsgErrSkuXUgdM6V1BQEEglzgm0slACgcCvb1 JqRbqPEuHe0rwmnqlelqtUi2UD/AOjR34eqrDyIyK4P+G0BCELsHEBCEIAEit9U8ktccMCgDGdfGx VaeDh4/wC1XH5K29IlHFp/GR3ifRVJxXMzr9s6mD1ocp5BPbExRcnXHBYMYIlA4u5r0iwQDt M+ELzWfWKnNOJ7FMiEPIKFyVUudIwK0LouHua38wfpWeNyPJaT 0ZP/AIaoNoqnxa0hb6b2Cuq8CyaYqRRd3LD7TVvVqjt7nea2rWD7E8 wsReOs78x8ym9R0hbSrlnSuuXF0nBJnQFLoKQHLsKCRTlwolcK CRdM4HsUnRNS7XpO3VWHucFEpnNLpvxlVXDB8o3kFdTFjq3mNd va094lPrrro4QIQhSAIQhAFB1+0VeY+Ngvjm3HylZgXLbNbbPe ZzBHeIWJvZBg7MDzGBSWpXKY9pXw0OUhgnHHBN0k4XJMeI8dZS 6ZMlRAesvRbUmOAjzx8UMhHZKIPyUByS4qpcXTOK0Hovf7uuPx sPe0j0WeUzir/wBF7vtx/LP6ltp/YhfU+tlr0/8AYlYlaWkVH4YXnfqK23T/ANiVi1pf7x4/G7zKb1HwV0vbGiV2cElKlKDxxqWmtqcCgsjhcuEpfYguUEiaW3 sSmpNLalBQyUbVq3VvWSgf/Jng2PRemvB1IqTYaPAOb/a9wXvLqwdxRw5qpMEIQrlQQhCAPP01QvUjwWJaxWe5anjY7rf3 Z+Mrd7WOo7ksR1zcPpUD4B+pyW1C/Izpn+zyWFKJTbUouSB0rEbVMoqE5yl2c+nkokCHVwrspBcqlhT Sr70XHr1/y0/NyoDSrv0YVPf1Rvpg9zv9rXB7EY6jnGy8ae+xKxO0H3r/AMzv1Fbhpdk0XclielWXbQ8fjJ78fVO6jpCelfLQyULhKJSY+J OaWCkldCCULK45AKSXKpYXTGfzsXAcV1mSTKqSar0cVZsUfDUe O+HeqtapfRi/+HqjdV82N/ZXRdTD4I42ZVkYIQhamQIQhAEe3n3buSxDWxs2iodwpjvB/dbXpV8Unclj2lrIX1K5zk4f0NA/dYZvE2wupWV+mlOKbpiUFc46gNzUmzvzUYJ6ybeahkokErhQkk qpYWFdui+PpFU7RSHi7HyVGDlbejSvFtI+Kk4dxaVph9iMc/rZqVobLHDeCsT1tpXbXzE+Y9Ft5WL6/iLWzk79RXRzK4nPwOpnjXkXlyV1I0dI4XJYTZSkMlM7KUkApSq SKYc1xS6tlilTf8V4RyJM9yhqtEp2jRuix/Urj8TD3g/sr2qF0W0HBtZ8dUlgB3uEkx3jvV9XSweCOVqPYwQhC2MAQhCAP N08+KR4rK6BvOcR959Qg/1uH+K03WasG05cQAJJJ2AZlYfYNcAKpBbNIQ1kYOAG07CSZPas svRtii30OaRs/s6pAyOI7dneo5Mr1a1P6YQ6ztc+7IdhEbRJPamamr1oZnSd2Qf JIOEr6H4zVU3yecE5Zc3c/RSmaDrnKk/tEeaj02wXA5zBHEYKkk0aRab4HZXCiV7mi9SrTXE3bjTtfIJ5N zVYxcukWlOMeWzwScF7mpGkPZW6kT98lh/rEDxhMayarVaDAWEvIJvw2IG8DNVai4k4Ak79s81qsbg7Znvjk i0j6ZnBY9rrYH1rW0MH1WOcScgLxz5xA5q/ak6ddarGHOB9oz3bj8RAEOHMETxlKZq2T7RxIvPDABH1WsvEjj JcT3LoP9ROWvxIxsFOK92nowgS17if6T4QvDtWo9oZkA7vHmlX ikvg/HPB/SvFAXoVdXrQ3Ok7sgqDUplphzS3mCPNZuLXw1Uk+mDV1ySCglU Lo9u2sP0SgeLu6THkpurmpNS0kPdNOl8RGLh+EeqsWrGrjbRZr M+pixgJu/EQ5wE8JlXhjABAyCbjhTdvoRlqHFbV/wBI2jdHsoU206YhrRA9STtJzUtCEylQn2CEIUgCEIQBQek+0u+ jVWsBJLQ3DYHEAnuWL2XRFVzw1rHOc7INEkzwC+m7VoxlQy4Ll k0XTpmWtAO+BKynDc+zbHl2LorfR1qgbHZiK0GpVcHvGd2BAbO 0jbzVodYWH7oUiELRKlRk227Z5OmLACyGNxlVHRXRgC99S0PJv Pc4MaYABOF52ZMbAtEhEKJQUuy0Zyj0eNo7VWz0SCym0EbYE95 xXrhkJSFKSRVtvsh2vRjKmYxXjHUSzl95zGk74gnnGasqIQ1fY JtdDNksjabQ1jQ1oyDQAPBPIQpIBcIXUIAafZmnNo7lmnSLppl KKVFrb7s5xAbvjitE0pXLabi0SVhenrJVNd76gxLjngI2AHdCz yOka4o7pckmz6Uolo9pRx2lh9F6+gdWW21zjSDmU2EBzicST91 oxx2zxXm6v6n17S4XW3W7ajgQ0cviPJa/q/oJlkoikyTEkuObnHMnwS8MVu2hnLkUVUXyK0DokWagykHFwZOJ gHFxdkOa9FCE2lQk3YIQhSQCEIQAIQhAAhCEACEIQAIQhAAhCE ACEIQAIQhAAhCEAJcJXn1tGUi7FjTtxHohChkk6mwAQBCcQhCI BCEKQBCEIAEIQgD/2Q== http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wCEAAkGBhQSERUUEhQUFBUVGBUWFBQUFBQUFBQUFRgYFBgUFx QXHCYeFxojGRQUHy8gJCcpLCwsFx4xNTAqNSYsLCkBCQoKDgwO Gg8PGiwcHBwpKSksKSkpKSkpKSkpKSkpKSwpKSwpLCkpKSwpKS kpKSwpKSkpKSkpKSwsNSwpNSkpLv/AABEIAQMAwgMBIgACEQEDEQH/xAAcAAABBQEBAQAAAAAAAAAAAAAEAAMFBgcCAQj/xABCEAABAwEDCAcFCAIBBAMBAAABAAIRAwQhMQUSIkFRYXGBBh MykaGxwQcjUnLRFDNCYoKSsvAk4fFTc6LCQ2PSF//EABkBAAIDAQAAAAAAAAAAAAAAAAIDAAEEBf/EACgRAAICAwABAwIHAQAAAAAAAAABAhEDITFBBBIyE1EUImFxg ZHwQv/aAAwDAQACEQMRAD8A0usq70rrxZ334tcOZEDzVgrOVO6e1YoN3 vaDz/2k5PiWumc1Zxbftbt4bCuG1c4SDd4g/CRqK7JvI5hMOEHOH6x8Q28R/dyaHniWO1dPbrF4N4XDHXoUQJoMgGNqflNNK6Coh4HbV0x0Jp/kkHyjRROZP6TVqMBrpaPwOvHAHEd6vuR8qivSa8CJkETMEGDfr 471lQfgrt0GtE0nt+F/8gD6FWlTAktFxa9PByEaU6wpgA64psldlNlQh0HbV4SvAkoQ9z l4vElRD2UxacB8zP5AeqeTNqOjzZ/NqhDohNuCdK4IVEGYSTmakoQk7QfRUr2iu9wz/us8Fc6xuHBUf2luizsv/HPgin8SLpQqnaScErTivWFLHjDXQY1HDc7Zz815m3r2szUvKT5 MHEf+Q28VTRAmmnAmmlOAoSxPCFcYKfr1w0S4gcTCBbbmOuDh3 okUE56tfQi2xUcz4hIOoZs496pxqZuOCs3QqtFcj4mkDiCD6I0 gGaPTcnmlPWLJZcASYCfrZOAwPePotKwSEuSBmlJwXjmwUpSpR cXTLPJSXJSBQFnpSXkpSoQ9Q1v+7P6T3OafREIe3fdv4HwvUIP EryV44rxUQ9SXiSogc/sj+6yqB7Un+5Z+ryV/cdEcT9fVZz7T6ktDfyuRz+JF0qdpTVncu62A4JizuvSh49atqZ a3OCIeJbyTNBEijuwy94pmJwBOF1/khrbaHNe9jY0SRnazF0gIh1TMe17cQQeYMoOc4vccXEnvMoUtk 2AVaBJkknjeufs6katK7gualJNiA0NU2ExN61L2e9GBDbRVvJv ptkwBfpu2k6hzvm7Ocm0s4gf2BefALc+j9LNo02jUxoHJoC2+n gm7YqbpE9RCcqCQg6mUKdMab2ji4T3YqNtfS6m3stc/hDR43+CdJpOxSi2FWqig5TFj6RNrktzM14vALgc4bQQPBdOrjg dm7arywWTHa8FrTpjhcNaap2gEwON4Iu5qOynlltMHWVWD06qC oA5jCCNE3giLjfK5Nqh9F9C6a1VCy9OR+OmRvaQ7wMFS9k6UUH 3h4B2O0T4qoyXkppkqh7cJpv8Ald5L1lvY46LmnmF1VEtI2gjv EItXoh05eL2k+Wt4DyC8co19ikz1JcykhLDidHn5gfRZn7R3y6 PyuWlPOgeI8ZCy7p5UmsRsb6lHLhI9K/MsHAIemdJP0/u2/KPJDE6SAcGfhQ7Sn6Z0e9Cg3lREHqwlvNdW6xdW4ROa9rXtneB I3w6fBctZoA7/AFU9lGzZ9jpui+m0Gd3ZIJjcNeoIeMFldiQV4W3LqlsXbW3JqI LItIOqsDiACRnE4RN88pV4tvSV7y6nSkMbALgSHVCRfJ1N3BUn I9nc6uxrRLi6ANs/6lWmyU4eZ1wT5R4LR75RjS8lKCkN2XLb2EjMY/bmmDHPFSNrywA0HqySdUgRzXFaxtaJA2DjfcPFNVqRBadmCBta GeykCUMqvLs5oDSDILXAkHeNY1d6mcp9I86mx7LnHVN7Z3IA2R rRI5T3+aibW8AADeeUyPNF9RxTS8gPHe2eVrU55lxJUdb/AMJ2HwIKKJTFcSD/AHBZC6GXWpJtScb9abcEmFSignruSv3Q7K3WUcwnSpwDOJbfmn 05b1nQKkujWVOptDCTouOa7gdfIwVT0UzTbHU0G8B4XJ4uQOTq wNNsEGLjBmDrB3ooFFYA4kuM5JQge46LuXmsm6Wvms/cAPX1WrVXaLvlP19FkfSF01n8Y8AjlwuPSNpfdt4BC1u0ETS+7 ZwHghrVq4oBrCrOdDmUK8wSn7GdE8UJaTeUSWwXwOaPdDvTNCx l7tvE4Xwih2BwCYpEgXKmtaLG6OJGy5PtCZZ2j/cUS0JqQFlk9nFJptNUEAu6txZu0mh0byD3TtUzluw9XVLm4AgE bHEZ/dB8Cqr0WyiLPbKT3GGzmvOxrgWk8pB5LSeldkH2epUb8VM9zgO 6HLckpY6FW1KyqWu2DNg4ayfRBVarBm4btXLcjWNBEFcVLIBiR 5LDo2WNWm0aE4bdygatXOMnw3IzLVqzWjYTHG4/RQ9DKEkiMNZ2oWmwG9hErhyTnclxn7Utogw7GNi6XT4IlcKijm q65cF2iOI84K5tL7l5nQ0cvMKFGpdF3N+y08wAXGd7gSHE7SSJ UwCqn0FtM03s+F0jg4R5t8VagVI8Fvp3K8XiSsgZaDou+V3kVk OW3e+f8x+i12v2TwPksfys73r/AJneaKTLh0Gs33befmUJbRcibP8Adj9X8ih7X2VQ1nWTnXO4jy QtsOknsmu7XJD243hEugvhLnsN4BM09fEp38A4DyTVnGPFHFFM 8DNLuR1CzlxAaCSbgAJJKnMg9FHWlzX1NGmBdHafGzYN/crdYMh0qFWGMGcbg683QbpOBkX7ZWrHickrFOaRD5G6DMz29eZ eAHGmCM0CcHHE74gK0ZRspqUKrGQ3ObF8wCxzSTcJ7JB5FSFDJ 0OL9ZuG4YwuqdGC5u2/wjyW2lVIU3spWUskPpENqNg6iDIdGMEcR3oE2ZXTKoFawPJIFS i0v2iaYN934XAEczrCzIZdqG4AEm4XEnlvXPeB3o0RyrySb8ni o9jMwPlzdEgkRgXGNgJPEBBdKOhj7O8VKbZpvuMfhcON8ESeRG xaX0ZyEaNIZ8Gq6DUP5vgH5W4d51ojpK+mLPUbUgFzTmX6ReL2 wOMbsUaxqMaYDlbMNgi4gg7Clirc+wtqN02g7DrA3HFEUvZ6x9 IPa97C5stBhzTxEAgd6zKDlpBuVdKG25IORNvsb6L3U6jc1zYk HfeCCMRCEckuLWmGnYNanLlz7m7y3zC5tTsF406TPmCohcOhtr zbRm/GCOY0h5FX1rlleTbRmVWO2OB5Tf4LRw92FwMkXuAwE4i7arxwc uAT0H53BJRv2h3xM/c7/wDKSf8Ah5C/cWF6xvKh9475neZWxuWN5Zuqv+Z/g4pEhsBiyn3fN3mUzWGieC7sRmmfmd9VyTcVBgPkt2k7gEzlI6 QXuSj7wjcfNc5TN6ZHoD4TQ7I4BSXRDJH2i1BjpzAS6pHwt1bp MDmo2n2RwC072a5C6ugazhpVjI29W24d5zj3J+GNsCbpFnoWdr c1uaA0SBmgDNAEAcLl3UsOmHDWZJG5uaCu6bdWtp8NSepVADG1 0cJE3dy3W1wzjppQ1NVGXtdyKLIXDWaktSIQFnpN66owgFpLrj hpDSHAg4a1Ht6BUKdpbXp5wYyXdRiOsEFpa44NxMHXHBSFYRa9 zh4tJHqFYLDZ5YC7GIPkim0lZEVzLeUKjWHMOZgLu1fiJ5Kq1K RJlxLicS4knvKtHSa4hu1xd4fUqBIWXM9jYcBxTugK8WTJ2axp dgxrWNbtgRJ7iVUbG8NqAm8AtJ4AiVdLdaxGOiyC4jWfhHG7y1 q8P6FTKZ08yaypSqOc0Z9Nue1wiQAYLZ+Eybtt6yuqVt+VbB1l J4djVBa46gCCABuBPfJWJW2i5jnNcIc0kOB1EGCO9D6mPGHiei MtZwXlEzUYNl/hK5trsOK6ybe8nYI71jYwkyVotirufZ2nRDS0EyZkDE4dvPGF6 zlW/oraiaDhIHVum+8CQYuN0zciwupA5FosxtDtVVkatNmCSDZamEA l5kgE6NPE4/hSWy0Zyyyscy1948/nf/IrYZWPZa+8qD87/wCRWKRpgBZPOg7c4+QXhOK4yY65/wA3/qF68qhgFYXRWI4/Ve5STdIxXG/6Fd5T1psegPhZMj2J1d1Kk24vLWzsBiTyEnkt2sdlDWAM7DWtY 0bGtEBZL7N7MHV2uODKedzcAweZWuZPpmTIdBwOBWvEqjYnI90 c2gReMRPMLh9UEBw+Jvr9U9baJF4vG/G9RtKriNt/MXrXFKSsSydDl7CZpukApwOSGqLK7l92ZVpv+FxB4OAnwBVqsb 5YCN/mVVOlPZ/Uz+LwpfolbM+zNnFpc08jd4EIcn2CX3K/0nqzaHD4bu+/6KIlGdKHxbKo2hhH7Qop9dZpO2NXDytLqgps7VQ5o3Tie5XL7P 2KcyBe4yMRrKqWQ2zaesm9jHBo/M8hk/tLu9XOxUpF0RrK1YVSsVPp1a6rcwgC7Af6WZe0rIcRaWDEhtWN v4H84zT+latXsYc2Bjq4qGteTG1KTqdSCx4LXCYx1jeLiN4COU VNUVF0z50tzvBGZJZoTtPgLvqvek+RX2atUpPxYbjqc03teNxa Qe/Yu8mkdW0bvWVy8irRqjsICkMiWjNqhvx6O6T2fGO8qPK8GO9JT phNWi4vzZMgA6wTBHEQkirPlcOY0k3kAnsYkTrSW36sTP7WW+V kOWe2/wCd/wDIrWqtTNBJwAJ5C8+SyG2ukScTeeJvWeXRsADJJvqDgfAj0Tl TEpnJTveP4DzKcq9pQMjajorM4wiMq60JbrnsOwjzRmVBcjXgF mq+yPJ5dTqVIkAUm8TBcR3FvgtMZWOr/jcsd9l2XXUajaU6NZou/O1pLSN5GcO5awwl14djdgCt2LcRE+j9SoSCDF6gbfUzHNcbhnD O4G6VOiiQNKDGvNA9UzbGsqscx7WukGLsd0hOi6FtWe2WvdCf6 xRlG7ltQmXstmgzRve4w3WG/mI8tpKKaS2RJt0C9K8qMGdTmX6BzRfEGbzgLlF5H6TVaAgNaWF xcQ4ayALnTdgNXJRNptEAhkOqOmXOvAJvJJ260NaXNpgZ5L3nA AST8rRgP7K5+TI5M1xxpKmSeWsqGvW63NjRDXQZF10id0dyDdW XlCoSBLc2cRMkbrrlI9H8kCq5z33sbADZF5/MBeB3T3oUvc6KkqWj3IVhrOJe2m7McDDjAaSCNZ53q6Wem4DDg BAn9RXdmbcBENAAgYcEa+pNxjgB6rbFe1UZm7YGBUF7oHC8d+v mhupAM4nab/8ASlGVwLibtU+RQtqoAXi7aNXEfREUjAOn1TOttpP/ANjh+0Bvoq7YrxiVO9OHf5lq/wC7U81A5NddzXNzL8zNUQ9mdIvi8Dv1qcrdHKwBLHMfAmCS0kb ro8VEMwWhBoaTcDIkTGEB0RjrCHFjjK7KnNxKYLPaP+i/vb9UlaXUATMgbpHqkmfhog/VLJ0gr5tmqu/I4c3aI8SsxtJuV86a2iLNm/G5o5CXH+IVDtPZSZdGQ4RmTD753AeBP1T9p7SHsJisflPmiLYN JRhEVlU4HeEflBssncgcqjRKOtBmkDtHoiRQbky0FrKb2mHNDX NI1Ft4PeFvdht2dRp1BdnAHDW4Xwvn7Jn3LeC3jJzMyx2dvwU6 Wd+xrp8StfpntoVl8EtQqNIknO9E+yDfdsHH/hRVMBpBBxJHAxh5ok2wAXnDETh/ZC1ygIsA6X5SNCgOrIFSo7Na7HNAEueJ1gQBOtwOpZ9Z6uYXQZ c8aTnS4k7SZlx4q1dOR11FjqWk6k8kt15jmw474LWnhOxUrJdg q1zotOb8Rw5FY8kZudGnHKKVkkys0sDgCS4gA6hNxnfK4pQ3Oi TUMlznYRgIPdciMo9H3WejnU3PeDJeAJzbgc4AX5si/iMFFl5c4hoLiYAAvkuMR3wgnCUH7WhsZqStCFWHtcXE4i7CdsI qyW9zKoqMMOb3Ha120HWi3dFqtJjKlQMbfm9WTJE6yRcSSIzeF 6i3ZLe6oaYztKSxzbwAdTp7MbTCpQkgXOJrVmrNc1r24Pa144O AcPApyoCdw1Rs4qIsNVtOlTph09WxjJwnMaGzfthOVbY34T+5p C6CTpGJkg+5uoBC/bGi4kEeIULlHLlKkM6oWsH5ngTwGvkqD0o6fmtNKzjMYQQ6pg5 4NxA+EY7+CqeSMFsuMXJlT6V2xtW0WiozsvqPc3e0uMHuvUHYX XHiirSdEoOxu0TxXKk/dbNSVE1RvCvmT7U5waYnOa3GfwtAn+7VQbIble8kD3TCdYHIAb dRJ8Aj9P1oDLw6+3nXmzrkXpIjO/K0783FJbdCQbpvXk0m7nOPOGjyKq1oOipTpBbhVeHAyMxo8SfV RNo7JXNfTXHhFWU++G8OHiEbbggWXVW/qUjbRIUZERFuEsPBFUjNAfL6Ia0CQRuKeyc6bOOCtcIF5K+6HD 1K1box0sZWYxmeG1WtaxzHRDwwRLZxuH11LKclfdt/uspu3uIvBIIvBFxB2gjApmLK8cipR9yN2ac06xF8bvUb/wDaPdbKQbpXD8N1/CBjwWH9D+nNrfUZRfUFVhk+8bnOENJucIOoYyrtVy9V1Bg+VgW 368TP9Nk5abW09kZknRk6RO7YN16esjTib4OvZgfBVFtrfnBxc SQQdou3Ky0OkVOLmkmLxcOUlNxZovdlSg0OdKLa6hTbmtDi8mn eboc1xJ8FRcl219O209LRFSgYAABb1gb6lWnpbb217PSzCM8kO LJlzdFzDPMqj5YmnWnWGnkaWafMJWablNfYOGk0a70zs2dZKl1 7YcPmYc4eLR4qm2S3ObBaZBGBvEG8XLRcoOLqRcRoug7dF0ejl m1KzGnNM40yW8Wjsn9sIMt0pIGPaC6+VnXaInUZNy4dlF5wgb4 E+KZqMSzUl5ZvyM9qKz00sxIbVvJGg4m+43tPfI5hVYHA8loeV LF11N1OYzhccYIIIMcQs+q080uacWkgxhcYMeKzTGRBLQLjzQN jOPFH1jcVG2U6RVrhPJOWQq9ZLf7trScA2NhF03aiPVUSzHBW3 I7yadMztvOrMMEb7o70z07/ADMDLwmQB8Q/aV4o6oGSfeNxP9xSXQM5XLCNAXg43iY8b05XbolKzsAADZjVOM Y+q6rC4rldZt/chiPeN4nyUnaRoqNq3Ob83opWr2VbKIhwxXGSj7ojZneqcdrTG TDovG9ytEZKZL7AXGUGXJzJnYHPzK9tguSwvBC9GLZ1dopuOE5 p4PlvrPJaq5ixuiMeK0/ovlkV6IDj7xkB42jAP5x3yn1bFErSpp5ggr1jF1mo0ij37PnPi CbtQmFT8vWN7LVUa9rhNR+aSD2ammBPB2CmcvdJvshpwzPz5kF xaQ1sCQRrv1gqHyxl0WpoqgOGmwEOIJBa0txETcn6UV+4vbkbb ka1ipk6g4xLrPSPPMbPiFRcp2kG0lt2k24DEZt1/I+Cha3TMWWwUWtiq6KjHMlzXU815zCYmWkHdzVcsOUs8ttL3nP ZVipTiGhjgYqNi8iA9pm8HNN8mCkl7KBXyLy9t68LYXtOoHAOB BBEgi8EHAg8EplZqGnjGLNbc4GrUIMgvfB3ZxVu6W5a6qmabDp vF5H4WnXxOA5lUWz4JU6QcRutr5qMsvbKkrScVGWc6RQrjL8k5 QOCmMl22GlhwziZjCY9WqEoOuCNs5vI5nkrw6mgcm4kw+0tkyX TN/a+qSCNXh3JLoUzKd08AuquC8ak9c43EPasR8wUo7sqOtwv5jzU j+FE+FEVUxKGslzqn9xCKq4oSmIqO3geqiKZK5L7Pf5lOWvBNZ MOj3+aeteCGthFWoi88T5rSfZhYQ6nWJ/E+kwbgA5x8ws5ojSdxPmVrXsvscWcP+Os7/x6tg8ytWKNyEyeiayhkp9Aw8XHsu/Cd247l1kzJzqz4AuETq5Sr7bKDXth7Q5pug696YslkbTe5rAGt Dbo2/2E32KxTnogLZ0Islcjr6cuDc1rs6owgXmAWGMSTeqT036HUrI0 Cz5+Y8OqQ54fmmkNKDwM81sTyCGg4xhvgqpe0axh9KgYiX1KTj s62k4c72qZKokNMpHRboELfTfU60U4eGH3ee4Q0Plrs8ROfBBB wCtlk9lVjpAg59YujO6wjNMX3taLuG4IP2L2mW12nZReN0h7D5 DwWl2hg1YyCrT2U7KRbui4Y0dU0AQIaBDY1Rs1KLs1gc6oKcEE 7RgBiVo1FodI2SO4/wDCFMCpmxiCQNwInzCpxTZFJowT2iWLqra8DBwY4c2gHxaVWaT oWge2KyRa6Z20yP2vd6OWfgLJljUmjRB2ji1HyUXTOnG1S1rFw KiKXbQR4WyapNhPh0H++iZalWdddqVQ1JMkuBeckhmu3JLo6Mh Ngrklerlywm0jspfTzR7TooHKguKLou0FCiPrYoN5ipxb6/7RtoxQFp7Y4FRFSJXJfZ5lPWw3IfJZuPFPW86KEJcK5QOk7ifN bX0OpZmTrIfiNRx51C7yAWJ2ftO4lb5kSy/4Fibtp0h+9s+q34V5/QzzLw5xzW7gPqmaUgScSDPfKLrt8AfEx6oZ40RwKbHaEsftzYA cNUH+95UF0wJdZKpInMfRrNjZnBp83BWY085gG4qvZYaXWOsNY Y9p/TFQeASXtNBrpQPZbUzLXWpjXTe0bzTqtA/ktfqOlx5eqw7oLaS3KTR8Rqi+7tsLx4gLaKdWc3g3xBVpWrJLo VZ2wHcyo60mK9Pe147831AUq8wCN30CicpN94zcfMfUK4bbBMy 9tdP3tA7W1PNh9VmJC1P21duzDXFQ8tD6LLgsub5GiHDi1jQUN Z73hTVW9juChrKfeDilLgTJsFc2g3Lopu0O0SqS2RnLZjDxSVn snRQdWzOxzWzecYEpLd7Z/YzWgcFeHFJeErIbALKvYPNE2U+7HBD5U7B4FPWR3uxwUKBLWFG 2vtDj5gqStijLfdHEH+96kSmSmSHXHiiLcbkHkh1x4+iNtp0VV bL8FZYYe5fRuQ7P/j2T8rLP4Uwvm+dN3NfTWR2gUqAOqmwcwyF0MC0zNkLDVdM/p+qYqnDgVzQNx+aO4LqoLxwKYlQsPslS8Dcoy20Z69gHbY4tH5 oI9QibC/SaNy9td1Zp2E+P/CU4/mCsw3IzhSylRdq62i79L3dWfAlbVk2qS+HY3DmGgnzPcsQ6TUn ULa4f9N1QNjCKVZz2+BC2c1f8mmRg9zn3bMxx9Ahx/EKZNMqzn3/ijwCBtzZcT8MHugp7Jd/W/PPgk29x3kjyCuOmwGZZ7am+9sx2sqDlnNPqVmDlqHtpp32U/lqjuLFlxKzZfkPh8REKDs494OJU8VBgRV5lLXAiXa65F5Ms3W1 qbNRcCeDdI+SDavRWLIc0lrmmQRcQRgpDuyntGivfebklQ/8A+gWn4aR3lhk77nJLt/i8X2MX0Z/ckZXhC8XhK4h0QXKR0DwPknrF923gE1beweB8k7Y/u28AoQEthvUZbsDwUla8e9Rtr7JUiUwzIzseSkbX2VFZCdjyUr acFPJa4Vb/AOR28lfStollGmR+EU/BfNlBs1gNrwO8gL6YypT92Rsgei6HpuMzZOktYqksB2nzTlY3h CZIPuhuDfIIyvq4pvkWKk7Nc08k5lEXyNUdyYqO80TXd2Z1jE4 DXJQyW0yGNe0mjFrcdtR3MVadJ48Q9XvotlHr3Wd3w0AefVNaT 3lyy3pjlGvWtAqVmhgeKb6YY7OZmjOokg7ZYbjgZ1FXz2aVJaP yUXDn1hb/AOqTBVoZLhfsl1YFQ75817YxJ5nyCFsropn8xRFgfcT+b0TZLr Fmde1zMNqsbKk5hL88Awc1z2AkGDGB1KlVcj2eqHOoZzC0vZmV aoMkOYG1WuDLxDiC09+2ze2qp/lUN1Nx73/6WbNtbgXXnZN+Fx8wFyvU45ympRdVX+o6fpXg9lZbv9C22fo5Z Kci0VHOcwuk03wx4IZmZpzCR2jM6xsVYtnREstvVGtSzcw1jVl xaGNmQQBJdIiAE060uOLj3qOtWU6oeB1j4kGM4xN4nuJHNIx4s 0W37rsfkn6R0oqS/r+fJcbN0Fc52b9ooTDiY6x0NDsybm6zF2pVrKdEU3PYHB+a5zc 5s5roMSJvhPWPK9Rt4cbxF5M4z5hC2+qXSTiTJ1Yo8Mcqn+d2h Oden9ieJu/Kf+ohykuklvMFlwXupJJZzQC2zsngfJPWT7tvBvkkkoQDt2JUb ahceC8SUiUx7IOvkpi0YJJKF+Cu5NH+VT/7rP5tX0vlf7t391hJJdD03GZsnUPZDPuzwb5BSFfAJJJ3/QoZrG7uTPSNx+zP+R3kkkql4LMq6UN/wbONgqAcBWpx5nvVg9ljvdVtwu/e4+aSSz4+/wAjJcL1R+7ZwKNye2Wnikknz+Iox72xPJtzRspNj9z1nZ7RSSX Py/L+jTDgibuajLcNL+7UklSLfQqh9F7azckkoinwj4SSSWgh/9k=

معاً إلى الله
2012-02-06, 16:58
طريقتكي صحيحة و هي الاصل وكانت امي تحضرها بهذه الطريقة و لكن من ناحية انو يجي ناشف وكي تزيديلوا الما السخون باللاك ما يتخلطش مليح
امالا ولينا نخدموه صوص و نرحو الطماطم والفلفل و لا ندقوهم كيف كيف و كي نوجدوا لاصوص كي تولي تاكلي و لقيت اللي في القاع ناشفة تزيدلها لاصوص وترجع كيما لاولة هذي فكرة جديدة تعلمتها من صديقة العائلة ولما جربتها وجدتها احسن من الطريقة الاولى ...
جربيها و ردي لي الخبر ...

مممم دوكة فهمت .. :)
يعني أنتم تخدموا لاصوص على حدى في طنجرة ..
ياك ؟
و تسبقوا بالفطير داخل المهراس و تسقوا بلاصوص من الفوق و تهرسوا ؟

قوليلي .. باش ترحيهم ؟ بالروبو ؟؟؟

ياك لاصوص هي فلفل+ طماطم + ثوم + زيت >>>> فقط ؟؟؟
و فرضآ بقاتلي كمية من هاذ لاصوص زيادة ..
هل تتخبى للمرة الجاية ؟

أكيد باذن الله سأجرّبهآ .. اليوم راه عندي العشاء ..
ربما في الغد ان شاء الله ..

بصّح جاوبيني قبل .. باش ما نخلطهاش :1:

محمد حانطي
2012-02-06, 16:59
الله يبارك على ناسنا ههههه وعراسنا احم احم

معاً إلى الله
2012-02-06, 17:06
السْسَلآَمُ عَلَيْكُمْ ,,

أَعْتَذِرُ بِشِدَّة أُخْتِي مَعآ إِلَى الله و شُكْرًآ عَلى عَلى الدَّعْوَة الجَمِيلَة :)

وَ لْتَتَأكَّدِي بِأَنَّنِي مُتآبِعَة وفيَّة لأَخْبَآرْ الدَّآر و أَهْلِهآ الكُرَمآءْ ;)

كَمآ أَنَّنِي لآَ أَجْلِسُ طَوِيلآً أَمآم الحآسُوبْ خَآصَّة و أَنآ من قِسم امْتِحآنْ هذه السَنَة :19: شَهآدَة التَّعْلِيم المُتوسَط ’’ ادْعُولِي بالتَّوْفِيْق :rolleyes:

كَمآ أَنَّنِي أَخجَلُ صَرَآحةً فِي وَضْعِ موَآضِيعَ هُنآ فِي مُتنَآول عُظَمآءْ :o أَتمنَّى أَن تَكُون لِي الجُرْأَة فِي وضْع كُلّ مآ خَطَر بِبَآلِي مِنْ موَآضِيعْ :)

دُمْتُمْ بِودّ


و عليكم السلام و رحمة الله و بركآته ..

أهلين حبيبتي .. اعتذر منكِ عن التأخّر في الردّ ..
فلستُ منظّمة لوقتي هذه الأمسية .. و اختلطت عليا الأمور :1:
أنا هنآ و هنآك .. :rolleyes:
ربي ينجحك ان شاء الله و بوفقك في دراستك عزيزتي ..

و اشكر لكِ متابعتكِ و وفآئكِ و توآصلكِ ..
أكيد دراستكِ أولآ من كلام العجآيز .. http://www.djelfa.info/vb/images/icons/icon10.gif

و شهادتكِ هي الصحّ .. لذلك لا تتهآوني أبدآ ..
إلّآ في حآل لديكِ أيّ شيء تريدين ان تشاركيننا به
فأهلا بكِ في أيّ وقت ..

و أيضآ ان أردتِ أيّ مساعدة .. فلتتأكّدي أننا هنا .. :)


أخبرينا : من تقصدين بالعظمآء ؟

اتقصديننا نحن ؟ :rolleyes:
لا أحد أعظم من أحد
كلّنآ ولاد تسعة .. و كلّنآ فقرآء لله .. نرجو رحمته ..
نحن عباد الله الضعفاء ..

فلتكن لديكِ الجرآة و النية المخلصة ..
و لتحتسبي الأجر على الله ..

سلامي و دعوآتي لكِ ..
و محبّتي أزفها لكِ في الله ..


رابحي نائل
2012-02-06, 17:06
(عرس اولاد نايل)

تفاصيل العرس :
أولا تكون الشوفة:وهي ذهاب بيت العريس لدار العروس من أجل التعرف عليها وعلى اهلها ورؤيةالعروس لا يتم الذهاب الا بعد السؤال عن البنت واهلها وعلي حسب مانعرف يكونوا يعرفوها من قبل وطبعا يأخذون معهم علبة حلويات أو فاكهة مثلا .....
ثانيا تكون الخطبة:عندما تعجبهم العروس بعد حوالي أسبوع أو أقل يذهبوا أهل العريس لدار بيت العروس من أجل خطبتها رسميا ويأخذون معهم في الغالب خاتم الخطوبة و قاطو من الحجم الكبير(بياس مونتي).....بالاضافة الا عدد من النساء.وتقوم ام العروس بأعطاء مبلغ من المال يدعي زيارة.....
و في المقابل يكون الرجال في الصالون يتكلمون في التفاصيل و قطيع الشرط
ثالثا الحنة:وهذه تكون بذهاب أهل العريس مع مجموعة من اهلهم لبيت العروس ويحدد هذااليوم في الغالب بيوم الخميس ، يأخذون معهم (الفاليزا والتبق) ويكون في الفاليزا مجموعة من الألبسة
علي سبيل المثال:قماش،فستان،حجاب،حذاء،صاك،ماكياج
...ملابس داخلية إلخ
ويأخذون لها كذلك خاتم أخر وسلسلة أو أساور(حدايد) او ممكن يكون طاقم من الذهب يعني حسب الإستطاعة ، اما في التبق فيكون فيه عطور، صابون، سكر مول ، حلوةالدراجي ، الشمع......إلخ ويسهرون عند بيت العروس التي تكون هي بدورها قددعت كل أهلها للفرح معها وفي هذا اليوم تكون التصديرة وفيه تلبس العروسأنواع متنوعة من الألبسة كــ: روبة السهرة(سواري)، فرقاني، روبة سطايفي،تلمساني، ملحفة، هندي، .....إلخ وطبعا الفستان النايلي يكون حاضرا بقوةفلازم على العروس النايلية أن تلبس اللباس التقليدي النايلي ممكن يكون حتىفستانين وعندما تلبس الفستان النايلي يقوم نسوة بعمل الحنة لها وسطالزغاريد والأغاني من النسوة .......
رابعا يوم الزفاف:ويكون بجلب أهل العريس العروس لبيتها الزوجي فتلبس العروس الفستان الأبيض ويأتي أهل العريس وهم مزينيين سيارة العروس ويقوم ابوها بخراجها تحت جناحه وهي تلبس البرنوس الابيض فوق الفستان وياخذونها إلى بيت عريسها والذي عند وصولها تؤخذ مباشرة لتقعد وسط النساء في مكان مخصص لها مزين ويقدم لها الحليب والتمر وتقوم مرةأخرى بالتصديرة مثل ما فعلته في يوم حنتها تعاوده يوم عرسها وتجلب معهاهدية لزوجها وهدايا لاهل زوجها تسمى بالتباع عندنا وهي عبارة عن مجموعة من الأقمشة التي تعطيها أم العروس لأم العريس لتوزعها على أهلها بمعرفتهاوكمية الأقمشة تكون حوالي على أكثر تقدير 7أقمشة أو محارم وخمارات......
خامسا صباح يوم العرس:في صباح يوم العرس تلبس العروس في الأغلبية فستان نايلي وتجلس وسط النسوةمرة أخرى لتهنئتها بالزواج المبارك وفي نفس الوقت تكون قد جلبت معها مجموعةمن الحلويات المختلفة التي تقوم أخواتها مثلا بتوزيع الحلويات التي جلبتهامعها العروس على النسوة وكذا تأخذ معها العروس : السكر ، القهوة، الحلوة،الريحة، الصابون وتدعي بالقصعة وتوزعه على أهل العريس الحضور..
سادسا يوم السبوع:وهو عبارة عن ذهاب العروس لبيت أهلها بعد أسبوع من الزفاف تأخذ معها لبيت اهلها فاكهة ..
وتقعدعند بيت اهلها على أكثر تقدير 3أيام وعند عودتها لبيت عريسها تجلب معها من بيت أبوها : الشواط ، البيض المطبوخ، الرفيس، المشوي ، الطعام ويمكن انتزيد عنه الفاكهة .......
إذا هذه عادات ولاية الجلفة

منقول للفائدة

مرحبا بأستاذتنا الكريمة
هناك تعقيب بسيط حقيقة تختلف العادات والتقاليد حتى في المدن والقرى في حد ذاتها
نحن عندنا في البادية ليلة الفرح [ يصبح الخميس ] تلك الليلة أهل العريس يروحوا يحنوا للعروس ويأخذون معهم شات الذبيحة لنحرها يوم الخميس
يوم الجمعة صباحا يجيبوا اهل العروس القصعة [ الطعام واللحم ]
بارك الله فيك

آلاء الرحـــــــمن
2012-02-06, 17:10
مممم دوكة فهمت .. :)
يعني أنتم تخدموا لاصوص على حدى في طنجرة ..
ياك ؟
و تسبقوا بالفطير داخل المهراس و تسقوا بلاصوص من الفوق و تهرسوا ؟

قوليلي .. باش ترحيهم ؟ بالروبو ؟؟؟
ارحيهم بالروبو ولا بالرحى اليدوية كيما تحبي و لاتحبي تدقيهم في المهراس على جال البنة و اذا رحيتيهم في الروبو خلي شوية فلفل اخضر وطماطم وثوم دقيهم في المهراس وضيفي الفطير و لاصوص من بعد

ياك لاصوص هي فلفل+ طماطم + ثوم + زيت >>>> فقط ؟؟؟ اكيد جبتيها
و فرضآ بقاتلي كمية من هاذ لاصوص زيادة ..
هل تتخبى للمرة الجاية ؟

أكيد باذن الله سأجرّبهآ .. اليوم راه عندي العشاء ..
ربما في الغد ان شاء الله ..

بصّح جاوبيني قبل .. باش ما نخلطهاش :1:

اذا بقاتلك شوية لاصوص واذا عرفتي تديري نفس المقدار ربما ما تبقالكش و اذا بقات ديريها مع السباغيتي ولا المقارون و ضيفيلها لاصوص بيشاميل والبيض و الفرماج وديريهم غراتان !!!!! و اذا كنتي ما تطوليش وتديري زفيطي و خاصة في هاذ الشتا دسيهم مش مشكل ...
عجبتك الفكرة ؟؟؟

معاً إلى الله
2012-02-06, 17:11
هذه خارطة الجلفة و هي منطقة سهبية تقع على بعد 300 كلم عن العاصمة تحدها شمالا المدية و من الغرب تيارت و تيسمسيلت و من الشرق المسيلة و من الجنوب الاغواط ...
هي منطقة فلاحية بالدرجة الاولى و تشتهر بتربية الاغنام حيث تحتل المرتبة الاولى وطنيا من حيث عدد رؤوس الاغنام و يعرف لحمها بأنه من اجود انواع لحم الضان ...
و من حيث الزراعة فأغلب السكان يقومون بزراعة القمح والشعير ....

مآ شاء الله .. ما شاء الله ..
ربي يحفظكم يا ناس الجلفة ..

اليوم نحلم بالجلفة ..


هذي صورة للهرماس


آآآآآه .. انني أعرفه .. :1:

مشمش حنا نقولولو بخسيس ... :)
و المشمش عندنا هو المشمآآآآش ... :1:

من مقبيل و أنا نخمم كيفاش عامل هاذ المشمااااش المجفف ...
أتريكي تتحدثين عن البخسيس ... :19:

عطر الملكة
2012-02-06, 17:16
مرحبا بأستاذتنا الكريمة
هناك تعقيب بسيط حقيقة تختلف العادات والتقاليد حتى في المدن والقرى في حد ذاتها
نحن عندنا في البادية ليلة الفرح [ يصبح الخميس ] تلك الليلة أهل العريس يروحوا يحنوا للعروس ويأخذون معهم شات الذبيحة لنحرها يوم الخميس
يوم الجمعة صباحا يجيبوا اهل العروس القصعة [ الطعام واللحم ]
بارك الله فيك

اخي نائل
الله يسعدك على هذ الاضافة
فعلا مثل ما تفضلتم احيانا بتكون ليلة الاربعاء الحنة و يصبح الخميس يكون العرس
و كاين ناس تدير ليلة الحنة و بعد اسبوع او احسب ما يتفاهموا يحددوا وقت آخر ليوم الزفاف
في مطلق الاحوال الليلة التي تسبق الزفاف ياخذون شات الذبيحة و معها مصروف متنوع زيت خضار علب طماطم سمنة ............................
و بخصوص صباحية يوم الجمعة
كاين الي يجيب طبق كسكس و كاين الي يجيبوا طبق شخشوخة
و ثاني الفطور نتاع الصباح
احنا ياخذوا البقلاوة و الفتات يكون محلى بالعسل و السمن و المكسرات
و طبعا هذي التفاصيل تختلف من عائلة لعائلة
شكرا على التعقيب
خالص احترامي و تقديري

معاً إلى الله
2012-02-06, 17:21
(عرس اولاد نايل)

تفاصيل العرس :
أولا تكون الشوفة:وهي ذهاب بيت العريس لدار العروس من أجل التعرف عليها وعلى اهلها ورؤيةالعروس لا يتم الذهاب الا بعد السؤال عن البنت واهلها وعلي حسب مانعرف يكونوا يعرفوها من قبل وطبعا يأخذون معهم علبة حلويات أو فاكهة مثلا .....
ثانيا تكون الخطبة:عندما تعجبهم العروس بعد حوالي أسبوع أو أقل يذهبوا أهل العريس لدار بيت العروس من أجل خطبتها رسميا ويأخذون معهم في الغالب خاتم الخطوبة و قاطو من الحجم الكبير(بياس مونتي).....بالاضافة الا عدد من النساء.وتقوم ام العروس بأعطاء مبلغ من المال يدعي زيارة.....
و في المقابل يكون الرجال في الصالون يتكلمون في التفاصيل و قطيع الشرط
ثالثا الحنة:وهذه تكون بذهاب أهل العريس مع مجموعة من اهلهم لبيت العروس ويحدد هذااليوم في الغالب بيوم الخميس ، يأخذون معهم (الفاليزا والتبق) ويكون في الفاليزا مجموعة من الألبسة
علي سبيل المثال:قماش،فستان،حجاب،حذاء،صاك،ماكياج
...ملابس داخلية إلخ
ويأخذون لها كذلك خاتم أخر وسلسلة أو أساور(حدايد) او ممكن يكون طاقم من الذهب يعني حسب الإستطاعة ، اما في التبق فيكون فيه عطور، صابون، سكر مول ، حلوةالدراجي ، الشمع......إلخ ويسهرون عند بيت العروس التي تكون هي بدورها قددعت كل أهلها للفرح معها وفي هذا اليوم تكون التصديرة وفيه تلبس العروسأنواع متنوعة من الألبسة كــ: روبة السهرة(سواري)، فرقاني، روبة سطايفي،تلمساني، ملحفة، هندي، .....إلخ وطبعا الفستان النايلي يكون حاضرا بقوةفلازم على العروس النايلية أن تلبس اللباس التقليدي النايلي ممكن يكون حتى فستانين وعندما تلبس الفستان النايلي يقوم نسوة بعمل الحنة لها وسط الزغاريد والأغاني من النسوة .......
رابعا يوم الزفاف:ويكون بجلب أهل العريس العروس لبيتها الزوجي فتلبس العروس الفستان الأبيض ويأتي أهل العريس وهم مزينيين سيارة العروس ويقوم ابوها بخراجها تحت جناحه وهي تلبس البرنوس الابيض فوق الفستان وياخذونها إلى بيت عريسها والذي عند وصولها تؤخذ مباشرة لتقعد وسط النساء في مكان مخصص لها مزين ويقدم لها الحليب والتمر وتقوم مرةأخرى بالتصديرة مثل ما فعلته في يوم حنتها تعاوده يوم عرسها وتجلب معهاهدية لزوجها وهدايا لاهل زوجها تسمى بالتباع عندنا وهي عبارة عن مجموعة من الأقمشة التي تعطيها أم العروس لأم العريس لتوزعها على أهلها بمعرفتهاوكمية الأقمشة تكون حوالي على أكثر تقدير 7أقمشة أو محارم وخمارات......
خامسا صباح يوم العرس:في صباح يوم العرس تلبس العروس في الأغلبية فستان نايلي وتجلس وسط النسوةمرة أخرى لتهنئتها بالزواج المبارك وفي نفس الوقت تكون قد جلبت معها مجموعةمن الحلويات المختلفة التي تقوم أخواتها مثلا بتوزيع الحلويات التي جلبتهامعها العروس على النسوة وكذا تأخذ معها العروس : السكر ، القهوة، الحلوة،الريحة، الصابون وتدعي بالقصعة وتوزعه على أهل العريس الحضور..
سادسا يوم السبوع:وهو عبارة عن ذهاب العروس لبيت أهلها بعد أسبوع من الزفاف تأخذ معها لبيت اهلها فاكهة ..
وتقعدعند بيت اهلها على أكثر تقدير 3أيام وعند عودتها لبيت عريسها تجلب معها من بيت أبوها : الشواط ، البيض المطبوخ، الرفيس، المشوي ، الطعام ويمكن انتزيد عنه الفاكهة .......
إذا هذه عادات ولاية الجلفة

منقول للفائدة

الله أكبر .. بسم الله ما شاء الله .. كلّ هذه عآدآت !!
قد لا نختلف عنكم كثيرا .. لكن تبانلي أعراس الجلفة غآلية ..
و لا راني غالطة ؟

قوليلي .. شحال راهم يشرطوا في الطفلة حاليا عندكم ؟؟

اما بخصوص لباس الجلفة
فالمرأة تلبس اللباس النايلي المعروف و هو هكذا
http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wceaakgbhqsebutexqwfruvgbgagbcxgbgcgbkcgbwxfxcxgh yyhcyegbojhbgxhy8giycplcwsfx4yntaqnsyrlckbcqokdgwo gg8pgiwkhyqslcwskskslcwvlcwslcwslcwslcwslcwslcwplc wslcwslcwslcwslckslcwslcwslp/aabeiaqmawgmbigaceqedeqh/xaacaaacagmbaqaaaaaaaaaaaaaebqmgaaecbwj/xabceaabagqdbqufbwmcbgmbaaabaheaaxihbdfbbsjryxegez kbkagxwdhwbxqjqlji4rvy8zkym0ocotlifirjf//eabkbaambaqeaaaaaaaaaaaaaaaecawqabf/eacwraaicagibbaedawuaaaaaaaabahedirixqqqiuweye3gbk ahrfcmzump/2gamaweaahedeqa/aodty0y1vqsfmplgwjfwqswuc2r+sby/aktvjbkskgw0idzyakazx5h2gwri1y6emmydkq6fbytxsaczd3 oyy0siseg7qbjjqdlcuqsdzj4xs3ahtniwzg5bqyuiuyuu1jvu qqugxn+izgrypsivcljqbgb/add8+tggktg76usgtmskwvksxbczzd2fgfqnviupk3adnlgln1 flh5rl4t7skpwtymcepnjlk3xivbjw2t30jvalhejbxqqq60je qhuqwcsgiv6qbhsqprd2plva2bfglzntslv2v2xkpctlmqzmmj rugsqvclhxisq/ko4sskhz1hcstcqyv4yaqvls4qsctkgjfq2jdezl3ltslijzsf fjmykmpiejwugssq+6xopvbkloiemblcpacoowjask6ekquuno cgwlcbmbsvcoqnmwe92kq3soddfricemgjtd08m+uf7i18fo7t yot1cyojsqafu6q0vksx46qvxodqzwfqskibuhck5q0dsqszbs s43c2h92c23jxutctuiwfyqwlalqv+bechvssw0bhcl4iywigk ghontyldj20ujs7hzqcke+rqqttwyewlgchj9iiyxydoqkxyzq nmqpd9vd36pswsfhzhif472ls1u0swkapqnyjsczafssbe5stb rhsa0esjpb5q/pirntbyrlggjfzmahr7tkkr4wxc6vkkmnrz1z1hbjuz2muszj6 uyklkilqot0mxlqzbk50j0jk3mup7w9skspkadwrxu2pqlqtoq 6gfkpel6phtnmnmnwknes+/vml92kmvmsqgabsk0fw7ahkewfmuclvamn2quzlvw6xvcdmkud y3grslxouw7sziqsfhxnpjvktvckfxk6s7arynlskvaouo4std jtzj0gefe5xl9v6esjyu0gjnso0razvqjyoideuo2dlgkz8wor dqrw+1cmajsgjbqbulkakqvf/wbqy/jkhybh12h2ee1kbnsnjifisnwz7w68+mumbqczplwn6gdk/ucgvo3fufoz4ykstm9dfhw/oynklvwv2/yxds7gmwixu6rdqsrwsxuqln3qelpfohuvaiz0xmgjckossokk qulyiqul3okxzrx6qnhz6zsgypse1ukbsuswe7risctwpz5gsb 6g7g25qufkrukutq4uakuhqgsgcliz+hpe8mpjcvk8+m09h8xf klowhfjyfbe7qrcczsa2bgxtto7jkdgkgyjcpcxllwswqoaki7 kawb0yaxy9t7qjliuumsfsqz7yva3cnlvahsrn86mmp95xisli deqwwqepzjbdbiblcujakel0xzylsvo/5emwizf5bridj/kgviaomgzvxjuuv+lofu+rb/8amfgw/rgr6pjfbpmjmxs0yk7tqaneozd1bnrhrkhg+ojrb9ovcyglt4i okl2zsiuhmyfvi+slcybxunwtdfebktcij8sbaec2+pgav4moj/wm/wc0tw5saw5wjtscwi5f1bcuz3kqmpiz1kab3azycmzpziuzpm2 xjpcx3spqk0hswfalzn1bzfoj2htwpcxmtylklc1hqjiguovfr 2ltdvmoonunvmpkfskit+4egkulavqwzeecpwv+c8emhd2p2ec znfjma7tcgiuo72ihknumwpostl7pnoulsvd2ska/ku1akoddcg8sd4qtcwe1kmwjnrsn1khrmgzxmrd3sjgjk1avnb abfsfi6lpazfjosmtpam8ewwftkvfratnzp3dat1dvhntmw5wd g2voonqympcxe8tqsk0uxbfk3ifk/gjap1e5ge3/acw9sa7vnmqaq9tetdslcoafvtlhtkoxpgly10eefzpiacqpiy kmtde2diqr1nudvkpx5sslw8zewgolcdc48k7gyh2nnqkkb1p8 kqdtgyfo9xlsqkbnjbvyz59hlwiex+krimsaskgcqesd4isdak 1khurop+op17i1kxtlo8x1uam0zrcfbrlkw4dzphctbraashj+ usqt5pfghjgyvg2pbn81dnzh0f4b0mnylrphtffw/jmjzakmwbfjgy86+1qgssmwpjmxnisup5v6x6jolpjul8rt6gp p/trwtmpbajqfi2gqb9bu6ez8o9ifrmq0pfs/2jxgcofm4qqa1msopayywahldzeraxbi2pkkt9mijwilmwuorf a2z98wlgopurxv/ect9uy8iq6+imyt1qvuumwswccgqybkpfkjlqx4xw5spjxmtjl ixyglqki51ezjjcwkt5aq97s7sw0prljqx3isghl5oarey53bx qmeo7viqgislccgbliypwzlsp+nm4717vhl4o8l1sw5sm8dos7 6cf9o5mquqse0taavbtagkanu1gkhmz3nrcoezo1pax3nk0zeq 8avl94pc7ojsshifiby9srgursuctrc3bsm1jkirxkxznps130 h+naijbpmj7uybuyski4lefjidscxuh6glziplzn/ab6gpajaipvczaagvkfyncqnwv3atnykgwgtg9njazrxjvmmtb auto8soks6hz3tbkzte9cveycaynn7yqolw4nxltpid1fmuczk jkllsbhoogxciae5ll7yxkmhkhda2csrqubzaxgd4ukr+slx2y oyfsppmistgexbqsbstwi4uhbyl8jgqco2wmfhpmadialgnal5 rkabqnbfiorgctjv+ubiljn73htj6wujdbvwfgkxbypjas3qq3 aqx2armnvqwl0iqlyjswku7dl3iqdvdi25q4l4rknukz56kjy+ um2kzra8cjyexmny3idqu5vyaukl7jgrex1i3bslo7lksokiuh qwwaqdblmalumrnyteob2umqvunl1lbfrdkfijlmcyhvdb/wdnjzlzlkoo6c5apg5pae2m/qesjti6nofscbfs2umwhk3dydswbiabzzxmyrcydrfu2ttilk6 1hxmcnqdu81g2usljpybsvh8bxsduadjgvwb4mdmhsc4zqhevj u7iyauan4b72deh0ifpk8etfk0qvmzj3q5yshpxqerxx9pznwh jossom+zuswzlmaojh9oyctyhev0guvffrqnv5tycej0thozzv xk7yt7kbpmdau9a0laiwuru2rwwluwflyj0hctxuugydwsznhu c4wbmx0uznwl0fsbebqt0kfw/g4tkqipxwespk3dghvdfrahitwyml0gscgkiqqgto/m8yjcfvtuqgypzgpaoskxcazjqhvo1jswyt3abncvvw4emwvkb khca96o4u/a2hjmbngluq7e0nqaxhiyhs0l3btjagbx6lioptpxafmmfst0w 0ya0gxplrzht32dyvactujjsc5cxa7axvodpok5202sreykkkb v3ivakdut4cw/dldyuk0bbbw92vlncvtfj0yzjmluupckuw3rkoa1ywc9a/uz6corsoewub7rclbyqsaxhr6qxvmjd8/q8cdjp4ms1lfwov5kaimg4qwyjco+klxptapl+1ezvzmusjyby tyaafr4ugbqrxiv7xw3dimrnohadnjzxe2sxdbkxqxm1af3qab bipqlwnht7cogkxtqu6fkvdra9mlkaafnsr24rgjjuvgh1eews sjlwkmfnmwhcullvsqhrknghcscr5hyhliozs2riujqygi6zqu ansd8wpdjcg5tpc+dlwblfrdoqxzinrwl68ojwactn31imt5ss 5d2kqss682sbvoyuvoxtjartmaihc0kwmygflo9n0lmb1qtzos 2yjbyp0tsm76xvpe9jcc7ezknxpke52z3qzh5oqapcsviav3aq qphnaewseekwdlglv2qw/fd2kkx3culaiobperkacfbjiidg1s75h82bg5vxdmbhsdsr2h7 gpcejupat0xoztmd7wmj1b+jsv0d2/omhv0fuf9l/cpyh8hzthe07mrltqgkqjjeiiyoqobbc75k952iezixouh7bgp w9zynb6ei5eohjdag87owgbz+6l9g+ymqdmxkvlsjczkhab1eh ewc7ugjs+almwalzore4ur2guvke6wqdlmy2nqqbcsrw50mlic rtrhu7ggapf4x4/wbm+xuwyl8skbetshs/iuskik/pa/oi9wtigyjkswkameovwgaxhfiljcxukjvugfitwfh8oj+8ieu2 suelhaqpxik+4+snipznglg26m2gspbcvevpkb9e+kzomfipyp ul+xozjehtoud45kjzguerqrn5o6j2kp7civj2ejjvlyig0dht srnwlzznyfkhsov4iunypueingkafyrdciomfxe7ee5cs48x7e 4q1y540pqew6cd61rbdly4tjiu/wdye+xxdcmujfchucwwkxtoomk9hdphzije0xovqnsmzlfpnvn eczzq80/7vfknycp3fckh0mhk2wueguxj0paetgm3vlcm7hlhziroput4n p8aarua8hreoeukugbnkgfrxsiam5/ub/7rd2xxfwcznofi3qi4ccyrpwc68rhnn2n7tcxkkhvgvedjmpby a7yvqxbz6zs5oh96y88xsvvg0vxdkmrpznm4c7i/hpeubbfyqsvltno/ytjl4cdlda9g90pjlxfme3napz6x+cnod8dbq0sd0td+bnxi8z 7uyluvgrd2jsti0ikqguhysun5gov6ivevgslkj3vendsfo5cs rdtbbn2jn7rkjokpcf1sq7qupsaxa4ajyfumdi7qzk92jysjkw eutikzpifdsgk1fvxpsggjxgyqv2ns83oum9/jt9tqsfiguziqzeflibruwzmatjjik93lqkczhvvg/gj1bygvhboimflphcniohcb5xs51fra2n2dmkcwptpmxiwni1s kvbmn2rwlvujnjbs9hbuzkxmymuhmixuwwmpkyojukqqukokkk rmmicwyvhzlzuzcksfbkpcwtufraussfunwl7fgaxthk+yjmpy quomkximhw6qqwjuvulja0uxakci7ry5paxu8gikekfru/dswoy7j/wc1nc1zjp/6raxensbix0e4rkvjb9ojhlonefulj3pwqubm1n6runpjhhkiv ksljyjidyas4y5mdegzu1kpm5c1estce0aekmn0dlmcltpfygf oksvpqcjdubmwglwztm9ng7yoyvvs5qzkkupslrclvezmmoc7l zkbadyzva2dfno0wtynbcqu89dopypf76ok3ydgseut6w09kgc lqinwqxb5iplfykm7ez/xdiuc0xtsmquutjhgxa/6g5hkqx6vrenbn6nwhnlplpsgm+ci9vh5ibwc/wdayey5mkdoidajwsr3rsgpi7pqwsurxpxurkpln6w+mqomvkf ihyrwa5prsij2rj/ebgqt7akw02l2vvmpmkwkjzaadry5f8r9ykts2tngeeuhrtrzh f4wyj8xmuk8fafeqq7i4wyisrmdww13lol3/wcqqlvmwrllkccdugbzyeg71jxmvta21u4wucp2wcwackkgg+g ztwt0hnzlun8x7jvvj+5h+1ussi/d/wbvuukwv2bjuzclqniqwr/pp+izyvmr/afemgiusnwgaxlcustr8ibew+2o67f6d8i4tkptlhih1ki5npz j6f7vgksyvkwy5w4ujpeei9g9mtjmwkhaleekbhrb3xhtdb1oj rjca3uqq7m7tfyfoiteyzgqaaoriayz8+szt2c2rv4g2y0uoa4 x6g5ifuk20lcwy5rjtmo83g6pnrevardzzmpbckpcjsaxqvcb8 qwbfrfd2sn8n6+rrvya0nghgaeqk23gqsvglcmtls4z32y80ce fbly33pfkgavuqws2rzfga6s9g1qytm2jzkekt4kzjkke5bdyq knkcq/kcu0/zzc7dnu1vqlatukbfvndlbk1cwwauaqng0jkpkzzpwjoapmsji pffa4ljms0qzi6t45duwuoyb1h12k+7tcaigpncxlkpuslsrqf tfm7m7ju3htc6q+004txhpksb3cuqfisqwpzwpuywfxzhdnxqq acclzgxilqb55vforkilvprmlavfkxsksmiyjqpuxaqqg92o9e kagfazqzai4bugjw31nuwugjwe5fwlghj9aqxwe1vdxkqiswe5 yusmq5lawd2ayaqtxgjjnqmjmllfrjuqsoe/2vlyjiahw9ero0i2afop/nhngq6l7fngabwhnhcy5rnmzrubr3jltwkprby3f1aemdwudfh agczwjcaqgx31delpacvpogtbinz84ztthfjhgpm626m4hrgxs thd1ohflyb48z6rbs7nrzjwfb/cuzlsukipinzz0kb4xfqsre2q9w7g7mmrdmrxllqgybyjcqrww bfnhm/zneoxijq4deakidwa5daohb0sm7uy9z2topqhjialgwyiau3mh pleolbs1xikusgarbmer+ujmv4jh/aw9d84ezjg8hoeogeewj/wcgocx+uxrr9n2xltmxqeyhqgiz9k5wvicdulipuv0sfqxw9oj dpn7hdns0pkby/lmkvf2zksprzb6futx5gj1n/d/ib2uxzriptzszmmwbnf2ezjz3aeevijkpztuqhktzmuc54uhhq xdduza5raafvd8ydw+dcrlmz+/3d2wztbewwucvpyecdjnq91n7ia6rumknieg4j4ugt/ay9bwywuapio4a72fs2u2vgyqnarssfrmyxurozbozb+fpoanl zztylzuek/xak5sscgbn8bacqdjtjp/1pqzm15kmzfhs29yu6muisyu7d7usjsfguo/iuhn3e4h88ivymuqkkm4bbnaw87esvirswdpufzguplsnim7dq zo/d0cychpljqo2noywzdmwcuvnrnl8sd5q5zaddfpmgpw4suqdcj slq9oifdsajsakmaaaoqitfsmzxkfewj+ek1ex8auvqb2zx4my moofm3uhyajyliegxk+/5x1jstkcx/4cxm5lbiidcuq11efbew7p8x8yl3kymgkx4ep2xwmrxqkh3klc wwlxwi5rvmkavy/7h7witcxger6z8kej9rdjncbqcfyljwgsbzblsbwsoenwiis4/zmimzqrlwpuxrckukhvlahobgwcdkl59qo10tpqjkqurklvutq z3csalnjbzunbxib7pjs3vyjzfjik90ws9w5fqcksxza0zqsns lkoxhh5uon5pomfszutuwkql91lsqafi4mkcwlgjzquoahjnjl b4uyfiplw4pqphhtp2nbpshiulmtczq6piikkqmjsey3iun2ob gczz7nzdfbfnmdmqhbxmf5omfze7d3+uauxd8ssoo0k6pmewyt e6i8zhatnygfjhvgixsrtqy1ccbelcje2q0u7hh4uryi9ykskg srnbwl5aaf/ikjinlapaf3jiavwitypakpbfg7et4nkziibupkubveaxjcchn 7aweksyfsdlmutkgupmjzsvoulssc4bbdpinxdxoy9a7g7rm6x llvvslrwol2akpqbypei2lhmrsshhphwxmqc50wqypadeaktua wjuxvvfyszvfv7iyhk8kdkimxewqsrqswvlugdiabkjxbrpt17 lqlj/jc8zczz55nqtp7os7xmpleiurcauhydueompmbcxucar5hwdzs iedci3i8plmjivlcehnnxpzwb9ipfwxxzoevoqpnsh/u9xifyupvlwzytujmf7wcrknezdzermxskps6qxa+dtosq7pxd ze4sah5+rvuweenkpwagsd+yerev+iknecyli0bpsb4wpswuok i1txd/q/coze6psl8lfe5rshzdv6ozkkgomfe/zwurd2yn1hreik2lxoubanrrthyqznnlb8cavgrcekpzsp5ohb pv+hdnobskkp1uecqyzse9l8tr84tinbnijwsfwwoettpdqa5e 7/mzkagrhq59j+6n4mcegeg58a9wdfdnqiokqf8lf2llkzwd2uas oaf8mlbsjdtlhsf2ow1a0kzmczu7j2qg2x2mmfdylcghzo6scm iw1hb4lzuwnlyqmeizdoe1scdssgluygepcpsyi1wbceyhwr7s 1qpc3lvs1mxg8ttjsps1nqko7bjyobxxngfhdkkgcoqjdyfiwy udqdc4ytae15cjqbscsp3clg2tkkaaznrbha/uuvhl5fd7hjttbqpyltfkmyc1eqzab9wgeeu/z5ifszeh7wkqmsh01qsxkbgpdokndal96pi1yqiawclpucbos9 mubezci9v7o9klonyru+zowfjmwirbrlmsylaeqzorfdivlilg xbim0zp+pkulbosh2lyyrz6xru65b2cp3gygns7dzjyjhyaxgh nwlszm9nctjkyzm+mtiiadlgfkaysslr7ptcksfqskrugfsepu spijrbi7zg/ar859occuzlssg1slk71q3itmpslvcv0zl3jppxstwrf/acbakt4yicxugmfr34xugn/wstpnchoqsxghbbkmhecraafkqf7oaajkrmxaz8dm42lt7qqn8 gdjnbpc3eyjfd7adhf3qihjblam3z5wtwfkj0rebx+4ywsilkl lqtus1jzkilrpbopgy6qh2s2kzoispzllwo86qj3ld9tl3+jud jpmiuyzuu4qsegsr9axadghajsozklhdqstvscn1bsxjoycudo errpnk5vxs6pxmeckuhjz1yfixzhabo/testcwpojdm5zsrsexrejxkmjokgagi4ksbb3tdwt6xyj6iql2 6fiwz3c2y1gcnyskbvwafvsqyerureubu02jpdk35tcciy7no4 vc7pdmvkpjcraofruplrlkoguisav+pjbitwh7iluyupzja98g l53zossxq9zz6ohfwfkislpaujqfcpjhupvcwykk8jo+t/bg1dh0hlb3mjlybjs1bcb55ngw841u3tfzneqrolssxyhm/8a7rmjiq7ukjgst6bibzmk9o7cevckpa/ervetwbs6csrjbl8yvysd+m2rhu2cedcig9n+ygmgguks/wbfknz9qlafqb5tf1eae4kgtcclietmk6nicr9r0pw05x0piy/wo+bmc92fll1jta042pu+jjges3wgx5p2hl0tpqryd4w6g/uij0trewosefdt5byr+5kff9ot70mea3zd1c9tk+kkjqndospn rw6vkain1kwveybiysjdglmzlsqsd6yqs6ca5idssjk7ur5ta2 hlkkwgadpqt8heh3puxrqh3acpasrqvf9lzulnkao27menuqje id0p3inrucwuznawh9sbagkr3s5kigyiqkekpyipdjoqru8gyr imxmaqaiaq6qrcxddwwblxpdjs/thsfwvvmpkwqbllxkq90kjbws9uuundwiea6rzdnnfao+dxius deryswglgkscqxlkbk1n08qfnmqqpekdoolnzm5dyb8owbnqre jaqalemqogoz3fn+fxhziozsltuokhnaqfvkuzasxlcaxdvsu3 tg3bmj6ecuubf2v773hzcywtxadrkxcd9kgmkk1yytuslrasqh vcsaq1zlgq/bfjx/xf+cf6hnszchmcgdh+towzzjnlajjrriyxzgegb6ts1ttyvqse mgbrmsuufze9vsvlnyulyyynoiqkw4qvxglcjoqoeoqsakb8il lvmu7dum3ogz5fq22sujnsvlnimxiyhqhuasggxbk2rfnhq2x8 vugmlvmpasqagu1nsvolm6q+eueb4paspugohnucmyqamyogkl 1qwewuxjws4/lyi8dhnqhfynlupadssgzgeen8pdwyzsyvlysc7kxoopkie7no e7t/yyxbmbuqtbzxawhphdnm7qfujd0ygt+fazsxkykjjzjovg5upj he8ydxe/diciuryj8bfvddym1natarwkvse0266vbjcsdwvdj6wywlihsa b6m598rs8oknay2usscghayd5xkqxqs3m5xsgj0mvpbnd+zui4 118hkiaxs41ms6jnyhxiykxe8jstcd/allfiqokqqw5gtbnmy6sa2kn+dtij3jam0xvwfsnnz9aqksk/waavhynragcxnjy5e6he9dohsrdwxpkov2jdchyz9h88jeiwyu k/xl5quwc0pnjy0egsjmjtyvcery90utjyrimklswsrv+fowin9s +zc6zplkrlkgeuqi0zsjlmbhqrdjyh5kt0upq/axnsfyq8v8a1vhnjkz3knm8y2hmy90keewi1a4nm/tmbyzm2uxqe7req+8pbsqxfn6x7bjmomakz0pewfudhyd28mhd thsrhjhkh3slz5lspq1edorhcv4zjnikzytejiupysa7zn0itd lgantpi61k7xcapixdzazwhtmpghblbwho0/swmkhuidjm/tnsd71j3rbj7o4zdhkjklbiu6vsyf08wuxhmbhsuqjqg8c+sis biljulavc12kqsxlahtva+fr6zwhnk2wzife7wtuuwk1io6vo4 iyscmhwdmfgysfmakshbkc3cfgwr2avcvcreycgk+k7kslgxhh voloyyyq2ruuryf8a1yboz7abi/dgoshdk4l9vxklx+xdla2ubwsgkpshlasqan0cwrlrumcszlss lowpmjmf6st6wfo7pzzk6zllj7zuqikbcp7yl7hzvh0fqq82f2 bwxoiuepuxoqqvomnwrsksslvrrjxxyn0hdhzs5ykywsa5g65u yqqrdhistyaax6rshbhdshlsacehncxwsqpsisuwssvcy52zsa xkdskbl5kpueqzvho4hkgcmu1jbkp4+mlrrhhue2autsrme8/es9vnkoxh25c9fuxmnkghe/trgsjmo+ycxxwjusz0jzmqzdrmr+y5dony6krxvyysopghftnd p8h0hxhm6recf+0mqvlz3ah0y3gu3geb4z5qdguwjnktqsfu1b vwx2el+vuhbtc8ygmylnzjgrwwzpxgdo7aolxgtkti13cm0zk9 axw7rao0zbljzgh9h5dymupxbzafpasyzc5c02n/pk0c9dwxkvdrcryscu8jcfxuqwvk6bcu/tqkww0kgdpwoxzeozshncdmvz/melki0dovwv5k/m0dlpfpmpoinhd6bxt+plgqro6frlhgcixh0kz9of2ii/uq0v6kb2foludqrq3xyxpsdqn0f+ynhcmctmaoi5j6gh3gwlm2 cgalahaap/2kqzfi/upt+iwr4lpmd/mbqwn/kef9jr+gf65n/ngq6v8aqhp/6xkdxr1otpwjkvqstkhjjjjbmusbvmyletilz9pnex5+g+rro5 jqhwagzsjp9o9vzircwyhn/ecpgod8zlg38+muca7afio+yoff/kmvmxilf4hxgefn0ddnp5jikvbip69mxyy/nracycfmb5gtazowklc1k6w2wyghlcushuesnplknphfpvpcsc hxbehuuguu1p8amydstyzm+tgxvaqk5njb1gibhvgw0tvbqdxz ybf20prbpbijsjgqjmjjh8/j6xzgkrq4mlrfvjkpjlvo72czxqviujtkuk9vaa3ysc8wfwbjg zcqszc2lavokwcehzzlpbiigozjuyn5b+s4s9se+a81fcgudw1 epcqsqhgcouwydnxsfna0bit+8+6ol0pgf+4hps3e0k8nexolf gj27w+trfm2ahw3erydkzsn06zf5iazfokx+fakeayksv8acdy v/pzibctbjpn5ijqx4h2h4qypoajcokfr/wcy5ccx9cii1s2ih0+hgxm/efmf5gigyv8af6v8qy4j5pp+n+i6q5opp/eckb/spi/zdanoecfz/wcuzedh7r/q/mmjg0cplcw8zealakncju5rwuy/plhjvn6cegscgt+z5zr0vaewfewi/wdgfexkfh+np5gikrirlrvzebrrrehf44xfkc9ffohumbpybqw orbidaanyvwkxuesh45w63ewhsobx6mcmabpfg8eu/wagrsmurxpe9az6uvukbwqtoad1bocesg/t+vz7y6vsgvqyhg8faghplpg19ikekw2sdl0y4dlzea7uxskoe xbfvyty1m2rg34jojmlnkwflquuxaletzghfr5rrdorqltjysx ymxtkcc7kaeh3g7om2mtnzcpcvenweqigqjpja/e+2f/aopjb/f8aawylyinxbrmkbrd46ekbdokph3hegbloolu0vrztpifp3ry shla8yqysyknmitczbp6ri0zhsmwuiexz06cj8ilbfgfyfr1hy ea+o4fxbuucesgzlkplbbt+pp15ruv9wpuffogrn4oohf2r13v meayaylrir+1j6h+ygmd9ntjfkfrpq3xjhsoq9f5gwdrjdgn/affzgqeufmblsxd51d5xkdkjq+zhh00c4mct1bnvkbkgagbnzp njzo9y2ugxuqjkbylitwt2icsyqwtvcohwyyqcxta5agj2tyt1 ozjyhwyjt4iqbdswtw5rilwc6jfl0jh2jhjjoqhtrnmbsslrmt ab8wrdgjr7b9jjpqqcstkc9q3sgfzit6wdms5noyvj7iup8nrw b6vrrak+d+ghdkkdswdbquec1glmgcsrxbmsbzys7lg9xa/10ifesequcpqvsuucqkpyhy1uayyz2gpwsyx/afgpmygarql0xbcxekzgauljoirja5kokyuhdsgkpsqqwfk97n ieyectsizt6igpubbqnqzblzw98zn3rlikkpskgi5fdrypll5w 37c0mfym6kucwd5pytp6arxid+wpn2ica8mgtdo3uldlkzbl8q xn/wdemcmokcmysgt0y9g9ynvymnrvuhh0i2yrtpb4j3/59kv/gyelr5w92ynxpqqppybvhjmevv8a5jzk8le7yjzfo7qqoozm4s ept+cdkv194jt/r+i0e/x8rxns4ssft9i7kzelycc3ckn2m7uugypj3rhsv06mdxzvp1yq ef2rmlmyj6wkn4q3c0emzmqtyzm5betgrru9szjzd/sj5rkr4sxgy2nak7xegwlaock3aniq2aqvaveef4red7xrlmmc mpiz2crcsj7ifydsypiqzkksxavdizlhipi4elg5tgup0smk12 murtx+mytghy8o2bakhadg+uaediooboibsblbsogxgueal2r7 mdw+s4ixqibrmpo/h84gkpkfbw3lw8t7qmmpaf7klc2ihxh0rlj2wfms1vvgkbikak 8cgfvmrczljwvvhkvhces1uhikiwtzzg2ricasoocwczalwhgz gv+czmkatcvusc3dizgkvkbkekoc+wazvsoobwgbqvjbd8wcnb m2ojjm1ywwpskiplu0qyalljay5i3dwcvu9xuhlclao7hrwppg l4a26a4/mcqptxpcrsfg81iqlnakqi7qbnv+da5ekmsbiqtspm87khvb5x xjwgsliqovws+qynoomsyccuzgnxclrhzrmy5x8nm4x2hcpe+d nh0eqyyyrku/nrgzakxop4ctaeydsikwulmozu4ozfrnwit7bljxtzyrgjax2j lts6gkg6ebahsxgl41wcgbt6vaefxsozku0u2fd42f8wjtgzwm zlchvqrkxdrx9okaxysfblrlm+mp5oopofumxijsturuqqdc89 7j6wrzllld6ppvqjvcettktco0zaok0qtvxfrdaj2wczjflapp pxocje6nucswsxkcvgrxqse09jsvalv3lu1zr8ofk7jkefcjmi lbruppa10lksqqugdkm6kuwuhsbqxxolutfdyqcvnste8yflnh kjfdqavpqou5cqbhdiwhfkt4gplvjugyf1ahrfhkyqt2tnxamk qmaqiwkfrvdhoali5bgnizyrtjnrmcwybburvefj4dij6mf4dc s5avtzjzjacivon18irqcxvpaelw0oqxp7uepcvfogcgofrqpt/ifncys6hcvftfs3apvrucrz2e4qcrhsra1aemywjvy9igxpsms f1assgshyspooajd/pzaidjcl3gatlmspjp4a6n0aif/wcm44hotlagkkukkt1+mjub4badmfsupaabiubyltzapclgxmc u3djtxv5hnfgliwfmd0fnvndri5ab7nqzradannx+tdgpk5w5s rk2kczjwgyoe5nukwcujvjb6roidwobr3qqbbna4u8tquszl2d s9ygltnej1zmbvluduktyedvirbt2ftwaztwtm3n9i3hu3fxm3 lpaek6etkqruc31grd7ucsx5j5qqkmh9hpmdeggkcul+yodopc 66ncdz1mqs1ivkykkhh6svsgrvlch4cl7oghxxwsj0yesddlmd u84c4tcg5y5z+kezcfujugbwvk7jzuym4wsaulsrs2lbtjxblp ek1n4mbwz5e+ivlw1shueansuxmwsxezf7hhxzhl/tuoqursfhruqqeil9bwi484d/oekcwqullfivzg3b1oabkhlheq8gwqdekdrrlqcsvvzahurgfq 8fe+btmykim6ypjutifkrc08rwc68ok2klexcuxig5ljjiyfqd ic/wcp/z1sqvy1gxmslhs+ypepp0gdmxyv0dovlk0iwvd4slnslkigdla amcmacsvilz5iiqsij/ecq5igyq5tvzkb7ggc8znzvpkqkesuusdox3vhmpbzgfermnjl lblhyleqbdqu1kbpnradakv8accjotyggc25xtgrdzjpkd0zuo lhpmwmzath5mr2xsmmflmiehvzqaaunhe511jwh7mjuzgfsalj qlpzrbxzxs+gv6wxp2llx+ihrsxszht6afocccso4ivkxnmmpr qclqy0h6lccooipb0nbpxk7hfvxdrzkkxegwz9ocdqw0xyukrl obvlfruzflqsh730jnbu6mxo/csagmbqsc7awbcke5zfov9npb3lpqlzqepakqwjdkixedqygaz muces2kanukfwlm+ze19ih/p0ixmmgaehg6ejkyprn6iepjn7w90cbxhetjmogkwkfswniegw vzd+konndn0ywfupc5n9zwyrb0fjngdw9shmumgjds0n4acyqm lhhopoc1vbal8brtcuniikqrakocvlf/ezmggkfndk5xiipyh359nyhcy0htikyukbyshi5pb3h4nxhs1t t0grzswiuuqzsfserbudho0tnd0p80hi8orjndwjr91cjebxm/lemf2yjpfr8qzjrbccopkjsmikhq0hvic38cpgysyhzsdijqjw ywyuo0pambm0a2v1+vfeujab4zqscslot7pmylrck2qziabbrd vzqhbyfgwd5q4qpxhdpz+bsnfwrz7rvcsaljt4i45q9wtllttc vesfbk+7pqa1xhbydtfc2xh0/e2zjkkvksdcfn8w0wzb8wokghqsprsash1c2odgyqbnwspcq1l k1quswc8hc+ymuzviztdnqsjswtu2y8qfkfhg8lnpz1opwvz5j 61accvoklyuof/yegudy0i8dcnnwxs/vogsqioznvluuhrn7al+l4jxeflzbqolk8wo23s3fqvkyxep99 asqej8hdsujfdvnyabp6aqegjizsylvplamwkk8yxuyygycblb jfr/mzdb5ckqsgo9xmcrytwhkfhaomsryhsscmwbxebji5aq42f8aj 4ud7v1c+jt0yygxaiziwjytwlisahdwzc6xkzdvsr5jex2gsu1 koptus5jyveh2gllbr8oymiumeboomy5npzvo3grohriheolz/wck+6mjikkr7izi/cl8qh5c4hth9g014dqvcagmjiyxl3/iowidn+me0hsoymgds7dnnb0zacqcogupmpirkzcswhbcnnqki oqvslf4hkqmjide8n5cjtfhkrl7wdha51kqcuuunthhximjuns/mkeiiyymjdl/nk2ombvsyfxyp7iiw11isfcq7apf6anxkq8k/gpxehiswazyg6gn3gekyuipfh4dlzzzrkzdo59easih/ci1grkmcf/z http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaakgbwghbgkibwgkcgkldrypdqwmdrsufrawib0iiiadhx 8kkdqsjcyxjx8flt0tmtu3ojo6iys/rd84qzq5ojf/2wbdaqokcg0mdropdxo3jr8lnzc3nzc3nzc3nzc3nzc3nzc3nz c3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzf/waarcachahkdasiaahebaxeb/8qahaaaagidaqeaaaaaaaaaaaaabaudbgacbwei/8qarhaaagedagmebwudcqcfaaaaaqidaaqreiefmuetuwgbbhq iczghssmywdhwqljtbxukm2ksk5thflrygqls8tzzssli/8qagaeaawebaaaaaaaaaaaaaaaaaqidaat/xaaleqacagidaaeeaweaaaaaaaaaaqirayesmueybbnrysjccy h/2gamaweaahedeqa/agvjcqscet1iyr5ktoxeku+mv1gamorpj+fj5bzzrlo0vio9l4 xq/fdq+dxog0jufrphrtlbp2mbqq3hsvq1hazv08oliry0amzjgu4/yp3wv18istxhltkiol1iouvtxfqk7ya/6cvhdhtpocah8kcccivlp1vhgdbevxpy+tklszudd6wbuhoi1v esqmc62216see6j2ayehlyi76eqhuusmbno+9e+tt661syxjmg bzt/5zwjbm9efnc6xchxkoowatn4efmqdpb1hlwlqyyoj7y8svk1cn rfgesd8zpgkycol4dfqexreomzi8h1dx26fjtkdmdlxflsugy5 gnknt69szidhnzo+94bimvakkduo58qxrrgkniheaesbj2zssk ilv+wduyiohtyfawmhyunwrsax3rt68vbbgehqxg3q1liq5gal xnvh1i5usougahlch8k29ymzsg5ko3ihh0fb7f7gplur3bvfut i7adu0xlhlrb8620dub5/nw4jem4s+jud28j+jftbdrimzgqpo7vpadticzx15iq5xbop7q xsi7zuywatrkr3dkamvpzcul4cnzrcweq3aabeqfbt3hg/pbfbxf5byhhreuy6czltymnbo5x1z0qs3zoim48x7ukm5oqbk6 e7l/rsg4/y65ycnhggwqqy9mv0jcxdeftb3umnoyhb7w5urxqfrlfxksnyw idgpzkk4agoyx+t68itmf27kzbcgqg+yxk/gi7q1aw/jenkganerv5uxtrvbqvly7lk+lsdf5sfgdvl/aad/aeywnt2pdldlxawkxiuyd+ey67ypmfv7o7jea3ijzicz+z9zx3 6yo1zxstevwwvaiycgca5tkoxxl8js65snvpij+woi2htzi6ef guelokxjwje70qstxkedibu8xz+lccqsrnaetwjldz01fe8ams rb14fcxszcv7fdrhhtp5y9/pfecm3n7hi0umnl1y5/rpnxqo8o/oi9mq1sucrja7u6ln62l7o33iksl7zmzu3qdkmsup4vv78/03bozheuxjutlu9hsdtypijsfxuegcnchzxu3c2muhisk8gdcc 4wmdy2occq7pcdfp2+plmt+znbczp/ajgj8aplafdmxj8qiccf52h9mpp0fd9vxbvu/wdbp/brpysk7yt53bp/anq97b/4qf5j/wdvfssvgo6omlumrrxwzw5xksacnvact6n4jawwi2q2z3yl7ig uew2kka89++lmc+zpveepca/aqkjchxrcacrow3b2f2zio7piosdmddcfi3zqykminykyq4oax xg653592otmukzbj++oixs2vpol02ezorug6hudovigpsdqkta jzzvvl9f7as4uz5i1bkoikycfabnspafoqnatmbtu1ykh2042z xtvruxw2sbxui62xtnvzgfjjn7hjbwq+ogxhlrdxjwmtyicnkg zsjqdtdo6lduxsptfqjfbye7hofhvkufhrckyamc4bxnjbue88/hzqtx1tjb8smcotdjh4lj2wenkdqflg9hxyrqsscfzvjirdxli f58gm7mpogwrkzjmv0rv0qygnboo4hjx08fopzmyll1eduhork c7yb5fntdhukvbe5uvgaz+zzhiw328cdlvytjuictuyu39qz7v wb7ahuvfkdpouc3ak3ecdnxv+uesmx1hs5zezzni7+njxoepwv qfhzyigcsfarhvu/65pmsp7imx4l41hefzvjemmeyob79t6jnhtmufkws1cjnrxj4f 61trh7coz7l840spok3z4t2g7aim+wbkii+i2qg7ks2qzc8mul 2jo2thebsrya48hyo7xw79+y+a/oonvus4walonahajnwmlp40f+yslkuxzljpujomurjdatjdkgx 7wc5pppit1vfyhe2jyjo0kbj59d6d7pvcxkwpnsecpz9fxreom b2zypwd+tg9fe1ksvjlodvpuavqrrfhnijuoefxeg3+44ppfyh jft3yymdplgscg6tnboziezia2g+wwbn61vl+ir7nog8nm/eoyx0ujxab6jj3+vdusoflz2lhchgk4zpa6/kqn6gxes8axi/qy2chu6fqmulwribnkhoxyefsbkp68vd6v041asnlqqnsncmsc qqmmufajuhplpkubpgnbxzsixam5aa/hnnlimvvfib2crjswuosbkjkmn3d60nxeowsbjlrawi3crvlcc x47cqnaatstxmzmxpz4b6hkaeclugs2eixksx0gghcbygsfp49 kuq8uadwuiaxtylmaka+oabwarxcsufljrvu5qe0flpz6umnxk 9bkmuzeri5jjo1ye0dqsmeyp+o9vd06sfwbok8vcswrezx9w8x 9d5grg1tmmqh1jsgwbnbj+hkhoj2yz2k1vopcykcgjltjpp31z q1qidozi5cr3ksdqwcnkup1qwb4lvzcsxewg/29/mkk4vytbtvhiurlokktgevaxryomjlsfuuck5jrp7lnqbshuiu e8evli10sf4q/kk07bp4tr/ilrrguoxzsfagtuwn/hsf3admvhjxvf1yhtyn7fb4yyhvupcfrwrp7b6hcnzynb8qfmk rngsbdwdjf77c/lnv30keqxds8tnk690up1hwp8otorokpbt1dkcq5yttksfpq5z uzyvj6a6sjyqsszysqdc0jzoyk8jw0ehtalywc5z8qpgnim9s6 v6aqvkvz1xklyqt7sn6iugnjma2krbfodltxht3hr8ao38n1oy +j0dnuhujgmxprc4x5dnxg5tebarifue0oncprz7q6ykkiyk5k ijhmuzg0nbzty1enzpxfacml9bslmlolilamwaudjp+t96n4xw us8ula2l7ds655eiobk8/e9/dxnovw1orrr1plv5yxge5mabhusd9zv5uw90akntasos95bxlo xw2rbb93uutnaq88f2g7p8a4uzzwl9y3bzbgpbuhagnpjnw6hx ry0iktsrznpzc7ezwd/z670ft0ztio341hjx+s1vsrniilljgnqjysc8t9vplzpxk8c0k mck+d9gqfivwl4gyvsylcqtumlhvwsvik5gcctrzv02qwssoz1 zsmseatt1ijhu5u6ekj6b8nzgf3cc+o9k6rsc9cmd/kuax0dpizpe6y/fwvowwg3cdpinhggzyqff3foqnx30vteix7xmf+0dyh7xajvic yigduvlnelyyqnhpoe20trpjiik9h1k/ivlip+k39xvzq5p6etfajir24kklko9hfxnvycehoj/yu7/3u4+ex/bxjns5dl8ckl0jpj2ckrstgd/zxt7vlsxj6v2cc3t6vf2tta4zudzcxknnhgpbiaxo/vowaksvdmsue4makdumt4shvdsav2ieyr1jmgkgnc5x3msw2vd gyzhxfmvrrh8xepslh9issrzaud+6uwyeygkzactt/o1w71dgdogxoggju5om+zy8zuffw1wzs9rm4ydakhcbnocd3ic vl+/rgxh4kxi/tom43/d8x41dayb7udqadxity+fv+nwi0i0x/zxsh2bxrji1soook8xziyfhpvwvcrpv7wkrgcicatzkbn4zig3 dsyzol2empifdr90+p+pre4ahie8dorgftcqd7ppig/lemobzo5g0avywcbbw/wcyg+q3os6kdu7lgibynlb7ayb3z3/gtfr/xjiharzyjuclsnic/ty1dfqoy57flswtsownju7hpll5isbizlaw4uj4gcqhonrpb3x 8h5v5xczfwjk0bawiwqcedgnunm1hxqewtvcktbaznokkfloee +/0rydzn2tmmf1idgjb9kd570rqw5nkdgzqf0cgntqwtpbbxk0r5 e6saqrnapmn3e6vswikyouquthhnfuqweccgkq5kyehs22ph9c 6vxsds0a8dbvzmjsybdmcah7q7hy7jh061zn+fzv3lj/dh5vcpsm6s34jnkzahdozlkfjqy46dpn5vzn+i/73b8dxpmttvieo+2azapbhxobzyail4oke7dl1re2gvgxmutop 6nkpjun80xlmwd41j8c0uo6xoliwxgkux8ltsknglq9yd+iwyu +lz39+fi86rcfcf5zss3gu1xt0cgh4fw68mmsvrdtaqbu3zocm jo25lb011sxutizcwll9fm+szeggjcftuvxqqiikcsexgxy75y whqbc/x8kqcnxetxardjehklftt1wpda8o/waks0gonjlwbkbsanv1x9oddbgk2nlkm0j0alncoosrngtkfrn uuf2bcy5cwjfmbvnyngrq+sxfzbmmnzkvvsmzypggjogzqgob2 1usov0yixbjbju9ks2/ckgdjxcxtjjzcmjpfa7ndly6t099bxxgiloygfvcrpiszevgli tjjo5aznu6uhe0dzrjglhjgyaksjpmabumudpacps3kxdz3laf w1r6iwtyagc9r4vnuqaqjvlq64leg7kh2szbylgkp0exhtavqb e3amkgghgngf1+s1llz3esiesq+rwdsywykefgxiip4fgo5yqs ei1rqdaahmctnbp3vwkpcsab8r2zsh9nlfchbx4uo4j6swckvh a30mnzmesgqlrc89sdlnv+vnbtg87k8trz161qvs64sxitzgzk xjhvdorp7ofxrsahl6s8xsuj2umdli7faeybkiymhgd5/kqx6nd+4/xryxwbwelskjfei9pv+jrmnft2yiyue2e0rhlsxfbvqx84w2wb vkl2jxazmoh4tjirdlcqcbfqb0umug9qghx2znkwpv+7kge+wa vfdeeeutbwwkiyy1snq5yvxihxwr765rcg7uqc5yqfzvr1rs/bojawtho7toazdocbdiplrt9akjyeykjcu67abvy7bjnz6m0lq ya8kglbvnyo3j062gafletwqaxvanq/p9yqs3x0+kcrrndc2dek4cn2hkfau9tn9znejz0gzsqbzxgmdp f8+tpdvoem3tjuyidlqsqe28m7cibut4z2x50bhao0ksocgrlg u+kcsdx3nlisq2yhwgdqpdzopptuasswsa9pw1qvll0h0+tufb pfllqogyzgacyigwz345bvhflpdrw7bocgdszgigogcxnmo/uo68zqt0zvknjtsxjwd8mb+fbcmse3ytoviwo8z9k5xkrjvx50 stmmk20tskedk51so/uhu9fjvb40dkrgegmkmybx693p5u2s6patsopsrawgpzbgxi6y z+u9ffstlhpjhtgttiriq6pzyuojah5z5vy/0wrpvse/drkbkuhvwij8k6dfhxclc5yfzv3gy9+1udi323e7urhnvm3xx2 +lszs4oecsq4hlvsqxu+broxn/aisn96nfyqele9h/zfc/3wpxakiqkq4+7sm1kezjapviw3pntphtskzymomcmszpxkyjh7 vxgt7gwj+qndtgzqdkmscnn7yevgaopo5cdxq2y/sh2/6tv2miewerqwvpgwudgcjnfvorvcb1zmt0kl24j/2qwallhaadnnnlea+oprvjtcemdwsv1ofagdyxfydfqa5pxltb d0knbvg4uwmessxqn2d+vs4ro/dponbxbdm0e2k4wccdix781scrsfnbrqvwm4admy/eajx0a606ilkwi2dbjlvgqm5wrnbv/kksywdqaaapfimmuylgczerkeyt17+vwidfickxpaib9pks7tk k5xt7utq8lv2z+ybs2rs7b4c43pwjxvzxuxf7zpeehxl+3pjco ccljoppg9cpexw281pgp1tn7zh0th3rjksdvjs+gavw1ev5url idfi4hjzb/wccnxpbcmrx++qfynpoolsqswwuhizl9jy76dmbuwwuw1dgdyf ufa7g6bniu4bbxk71qzfkar3x95ifia6bo2diwjlroyd+xoqey 8743rk+ofrxglhg3dxvzhx+fhilflwapdxkva44ni28s1okead qmerqryybn4ubnrlwewk0v0luccbcoigdztvvmtukq3pfoxhvh ouhxbk2ouonoqueaodtf0eunxiyybyaq5ony1vxtdqisl6h8ui m/ebdslznspnvjyk5ym+df28udsji4lcdykg53kgnnv4vffnszln onqyff1qrjgy66v3oowky5achgevdxppwywydo3apkt17s0vix 1ixbilnyhx6/gldu+mb5hdmvliqhgq2mhyd1ufh15fc3hfuhgggr4kvvteq4ty bqtvvvyoc6imf00cwkptzkz105bba8qgj4jex8xhijvbionomt gjntqwtngedapdyztnjpljixz/wnnpduf1tsozjlzj2cxlaajg++obm11kexmwriqdcgjjyovnjn aw7mebodk4xs64tur20f13lmnzofdfl37umvznodkyvit/cb/4g3tkxtz2r43kwjiylc6gbz99vylg9/lejx2+ucaqdajny5nbprdzekqz42zwyb+22/wa6amkqvqsrw3pipi+7lxbmwddtm64l6vvtdf4q3ntjazpdone ihdaehhwqhftyasxd3lod2y8ya1yo8/cgk62rnsk1f2jvpwfb91zwuthi8vl86juf65f+csrkmpkjpoef ve8/wmjfe8vwfzwv3l5efcsdmp10rlr7x99zwvvdcesf+oyf/ap/amdww5ezrkylh6axztd/aff/adundcz51lztipsx3/3v91anypurkyupp8i8oijvwqosrkgx2f/z
https://encrypted-tbn0.google.com/images?q=tbn:and9gcskgt_7oaghnnqzqzr6kf58in6twunaa hwbceoczs_eylismn5g
و له عدة اشكال وقد تم تطوريه و اصبح يخيط بعدة اشكال ويضاف اليه العقاش يكون روعة ومبلغ خياطة الفستان الواحد 6000 دينار
اما الرجال فلباسهم سروال عربي وجيلية و في وقت البرد يديرو قشابية وبري او من الصوف و هناك ايضا البرنوس ..
http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wceaakgbhqsebquehqvfbuufbuwfhuufbqufruufrqxfbuufb uxhcyefxkjgrquhy8giycplcwsfr4xntaqnsyrlckbcqokdgwo gg8pgckchb8qlckvlckslcwpkskskskslcwskswslckplckpks wplckskskplckplckslcwslcwplp/aabeiaqmawgmbigaceqedeqh/xaacaaabbqebaqaaaaaaaaaaaaaaagmebgcbbqj/xaa/eaabaweebgcecacbaqeaaaabaairawqsitefbkfryxehiogrob hbeyns8bqym0jicrlrjhockslh8wntq//eabkbaaidaqaaaaaaaaaaaaaaaaaeaqidbf/eacmraaicaqqdaqebaqaaaaaaaaabahedbbihmtizqsjxe1h/2gamaweaahedeqa/anxqhcabceiaeji1wxtms4rwqunnppuwhiobsjsblhk6q3sqoz jfo+8vmzpb7tjn4bqrb7wq70w2m9hcqyocartepauubceiaeiq gaqkvqoactkfw7trc57ikea37sobolkyzsuqu2ao7o86ezuxtq epvtzwf+irbyz1kkpzrwh8dut60tvoq1r1ceksaqhcabceiaei qgaxcv1ccmeau/tfpl6pboas6nztnl5xdwgsxhcokiaahs3vjyxpdj6kkar0w+0v nnwhjyhuckggxb+swyz2johg59fttguifhqib944k9mxgidbwv qclulbxyiiz3ebfs6vb1n8bsdk0co5jstllpez3tegdrbgoyep l/r3dj3+c21rsuik+be1vlaf6i8pv2younqvwl2ahu68acv7yxsh 0cqfz1cekxueiqgdydy3h2ohaq3stjkno8/advj3bxg32a/tc3efk2ufb15jdkc7anc9vkyy9wa4lbo9apra+9idwt3gz7tk9 bq2tdosbpwdsxkhl+yzylql6qbzbw5ddkl2eiwtzk7wlvllbxs g9x+2dn4e11rqbakeoafncvxovrzqd6ztvtslsuqhmbrzloggh 0yxgvo1gp3abrwnvtef2zn5oboyshceylghceaceiqaiqhaahc s5yapa1mpnw3n5xwv6rsf0e2uapvca9ndyr2qrvrxrttpuut67 xsby4uozks1tiqwh0zlxjbo0tjaog1lzzrf5g8clhknapplxl3 1hbyugey7m1yw2d4r+za9zr7mtdtnlnaa8f4dntvsnlxndyycs wpdr9ks61op3ywc6xxmwcc5p+idlml9npi1lj+efybm0jsrug9 ebnaxxgolh/duf0ngdkvyq5pxafry2muzqeiviaqhcabzb0gdsohrmoohejdy wpkp676bfek7ziz3ezfvnhcqlwltkmzzqtvsbkynatvuq0w+ae 4lem+s+m4toywva4hidtc9fv7ql6wv1jbrbz2upws/divf9oms9inac0q2zsmoh3s4rczcbjlzmivohsyyfshrxe2e6f w9o2toik0cgxhsbgqc8r1eeegwojpyuenzp00ajojpls1eo2mq +m5xabeaijoaeg4dqtwkwzvbrzrwyinl9rjg5pvhyw5hn4puse ssfb0dqhc2mqqhcabcfwoaatfqaweuiag0rota9ffandtsxibe e0bg8bgjxkx0j6cgfeoxcfqj4acseewfqmdicwlc2vrhdedepl cynua6cyzkm9iz3ztt9jqwzegidyiykw8jazjo5j3y9tl3zrdt tdknuwa8/xldpgyhktdnawxwca0htj2lebqzpc0qlznrycd6kbrhpmbrglw l5gayc23rbyrkmt234vivwhtcwe57mp3jtvs0h0h16unq++bvc yfe/ft7vt6dco5pbuiwknkltdlxxkqan30dpbtam2owy1wkb+io4gq ust1a0o4wltn1vzwxx3aefx73ridor6sjt3ruquljnvjzy8knk qooqhagzwluhx3wqoh0ek6xuwdd+6d9atsmkxr7rmalllmw52e 7rvkzjralq4zmne555yvhknxcn8eo1uzabbq7sn2o8ehodbmww pnusdynoxcgwiwa0znhxh0uns+lw0afg1oz+eko9a0x3fwkzji lpzvhdwon8sctdwyijjp1p+jdaracr2ejlwb0vnz1sgrpd1o0g 2ha2podxdr87a7ahvawvgrbgvchrgbgc7dy13uztht7m2tl2dr 2/d6ru0r3fmyjc7wjaqhukwbcejwrbceiae1axq08k6owlqkunck azfrk69aj+fsttkm9hd5rxgcbzuvtduutnq/iu/2ifa3cwuxklcmdxfgoodisg1kasmbzg4zbbwzgi5hsdlwttrzy a4anekiasfh3jzkbcmyoq0nlecgdoxaiyhg3yfpwj/iduecu1onufilqrlrw4zt6w4ezhmtq1y0ylvzmvpvrdxuemhfv 2hyk9ucbt4tktk6kz7iqnvtgnvb/aktwnluqettg42xlnwirdatucdve1w0wknb05xgn52bpt0reer 4mw1st5q2lxzdeqoe3x8kxoaukyfujadbub254djkol3ysttjj 5nfnkyepm70g3bs6shuuh60wp1v5c7/nabgutzhpysllijugcfrs2iubjsohjg9db6wbvsruexmrnqtpm we13xolluxjgv44sj7co1vs5e70mluxw5g8vkltsicvju/pvyk6owibx7whtqfhta7tix8vnxtttwcboeiqpaf5unvsivsuh tamk5agjw5vv6wp/wbheokjbskdprc01rxb72hrmwvyz+tovj5ihbnwf2gffmg5ltn 8lunuppcya6pwydnsjd3qtkza09ydigt2hdzuej1pjle+aumua 2vyg9cbiwccve+i2r7yq3ewhudhqqsxmgohak3dhl4tzg+k7wi w2j/tc+zxjzpxocylpa0oale5oaxjiza8b4rwbu6go5fyhro+9ax8i hab/tpznurharkede/pbdpnn52ja+eakmbaslokhtulzpsnhyexivsw258zz/osjipdgeakfotnrs4q6ksjvsriwwxaakg7lgpgcnqm0waqvgsn zppr7pgppggfrupi4scz8cy7qrgsk1qtdm22ld+8s0je0jh9+x a0e7p5boc/dm6ig2fh06hcewlgoukwttdyupcc2qgddnaajbapoacbb5yh0u fujvs6skdwt438oegz5kl0kuermz41nnu08rgttqbgpeehtmi4 rtosesvdwhisrgudgnrftkvofmnuikzu8fbks9w62rwp+zaua+ jl7bmbl507e5sejelomckdacxvw6nrgtahp+bh73gpqqozk1pu prvsrihh61xrnlkzwx7vtgi5t/gvqzbyv/0n6x29tkg4udd+dixg3vvoe4fect2eyrd0kvcxc8tg4gdzv8lx tg2ljkmfocx3s8twjtwsvun8f8mavrtkoi1pbca1otalgpphgs xgt4lljwsxfvjgnu/6mynyfdecarvywcuishflmqxslq6vkikl0x45ikqui19h1nvwu fgy49pho8ytpco3rpzckzzvawdgjpmfek5p1up6c7uu8jbcejg xbcccf1jfkuazf0kvcxsh4nnuahqqdqfjixbmrw4k2dit/es/r8wqvzafwg6prc7n5s6edwq80tie8cowbnd54pxj5s4zzid5ul ujhvaottbykn9go1cq0peir67ivcgkar+2co2xirgdhuhtmkbh tjxa8t2g5helpfrll6oktmnyylwbn0iejmfelabvndkbyp2ug3 arc+k1kxwsgiekvcszcf2wkjqmmzzio1thxnddbl2radc2gvlp se3aopsig7qjdsywgwygbogbgc1rnr9ac6xnb+497eybw/v4lfsupuk6txfm8lpjsbcxxayh3ym/aro7k4xqnomeuyt70jo1tvso71letmr9ozvlgglxbayymqniyz r4sx08+ujw2hljslyhfmpi6z2o5jcswjaf0uxsqqd34blgqhdb s/yzjfpzkrjlwjlj0wnwtxhnmuzb+clijiequmdtujmodznjakpn ta0hwxvho3sjzznpp/6pkcmi7pfpcrcuhi8ecrn5seiqttieiqeqeswm7qeqesamb19f 79v5xej/0q/y/qek9rxgzar+q/qk8azdfczn5s6mdwqqlmk2hsyjus2/wxxnlwwjurqlcc5x7mdqmu3khenxtyo38xqphs8j4x4solwbe5 7etchdavstlxytk6nhfwzxuqnxa1ztuwjdgp2fx+b/aihmabzqpqvaurwx9int3o/m7wac1arkekd7cc3eifzede8hmitbbchfdaxooqik5csnibqan cv2o6c8eq8goiy5vsdmnbcoqyh7sc08jgr4fo6psbe9rg4l5ah avfaddltn0xi2dyshr9qatznouvib2g7mpfhemkuk3glzqdhsg pu2mbkxoaowqpc4urqpvwcfseiqpae1apqhknu3ab1dyqbi2uo/ir+t/irxktvne7rs2lq38v8akv4iyc5ebzz1chghx2adpjamn4wu6w4 ljm5hy7d+r1u69s4z25lz6g3mpzt5kgchcgiljjuenx5lroja+ 5q/zb+lz1upvk0pou+xrfzg/pw+m9gtqvwxyrjde64noagy8e8x6lvrs+ge8csv1hrxrw/ha9t5p3o6ij6zfsgerrskuxugdm6v1bqeeglzgm0slacgccvb1 jqrbqpeuhe0rwmnqlelqtui2ud/aojr34eqrdyiyk4p+g0bcelshebceiaeit9u8ktccmcgdgdfgx vaedh4/wc1xh5k29ilhfp/gr3ifrvjxxmzr9s6md1ocp5bpbexrcnxhbymyila4u5r0iwqdt m+elzwfwknnoj7fmiepikfyvuudiwk0louhua38wfpwenypjat 0zp/aiaonoqnxa0hb6b2cuq8cyayqrrd3ld7tvvvqjt7nea2rwd7e8 wsreos78x8ym9r0hbsrlnsuuxf0nbjnqflokqhlskcrtlwolck crdm4hsunrns7xpo3vwhucfepnnlpvxlvxdb8o3kfdtfjq3mnd va094lprrro4qiqhsaiqhafb1+0vey+ngvjm3hylzgxlbnbbpe zzbheiwjvzbg7mdzgbswpxky9pxw0ouhgnhhbn0k4xjmei8dzs 6zmlraesvrbumoajzx8umhhzkipyubys4qpcxtok0hovf7uupx spe0j0weuzir/wbf7vtx/lp6ltp/yhfu+tlr0/8aylylawkvh4yxnfqk23t/anivi1pf7x4/g7zkb1hwv0vbgiv2celklkdxxqwmtqccgsjhcuepfyguueiaw3 ssmpnlalbqyubvq3vvwsgf/jng2premvb1iqtyapaob/a9wxvlqwdxrw5qpmeiqrlqqhcapp01qvujwwjaxwe5anjy7rf3 z+mrd7woo7ksr1zcppud4b+pyw1c/izpn+zywfkjtbuousb0rebvmoqe5yl2c+nkokchvwrspbcqlht sr70xhr1/y0/nyodsrv0yvpf1rvpg9zv9rxb7ey6jngy8ae+xkxo0h3r/amzv1fbhpdk0xclielwxbq8fjj78fvo6jpcelflqyulhkjsy+j oawckldcculk45aksxkpyxtgfzsxacv1mstkqsar0cvzsufdue o+heqtapfri/+hqjdv82n/zxrdtd4i42zvkyiqhamqiqhaee3n3busxdwxs2iodwpjvb/dbxpv8unclj2lrix1k5zk4f0na/dyzve2wupwv+mlokbpiufc46gnzumzvzuyj6ybeahkokerhqkk qpywfdui+ppfu7rshi7hyvgdlbejsvfti+kk4dxavph9imc/rzqvoblhdecst1tpxbxze+y9ft5wl6/ilwzk79rxrzk4npwopnjxkxlyv1i0di4xjytzskmlm7kukapsq skyc1xs6tliltf8v4ryjm9yhqtep2jruix/urj8td3g/sr2qf0w0hbtz8dulgb3uekx3jvv9xswecovqpywqhc2maqhcap n08+kr4rk6bvocr959qg/1uh+k03wasg05cqajjj2azlyfyncakpbbniq1kyoag07cszpas svrtii30oars/s6payoi7dneo5mr1a1p6yq6ztc+7idhebrjpamamr1oznsd2qf jioer6h4zvu3yece5zc3c/rsmadrnkk/teeaj02wxa5zbheykkk0arab4hzxciv7mi9srtxe3bjttfij5n zvyxcukwlomewzwscf7mpgkpzw6kt98lh/redxhmayarvadawevijvw2ig8dnvai4k4ak79s81qsbg7znvjk i0j6znby9rryh1rw0mh1wocscglxz5xa5q/ak6ddarghob9oz3bj8raeohmetxlkzq2t7rxivpdabh1wsvejj jct3lop9rowvxixsfok92nowgs17if6t4qvdtwo9ozka7vhmlx ikvg/hpb/svfaxovdxrq3ok7sgqduplphzs3mcpnzulxw1uk+mdv1yscglu lo9u2sp0sgelu6thkpurmpns0kpdnol8rglh+eeqswrgrjbrzr m+pixgju/eq5we8jlxhjabaycbjhtdvorlqhfbv/wbi2jdhsou206yhrra9sttjzutceylqn2ceiugceiqbqek+0u+ jvwsbjlq3dyheanuwl2xrfvzw1rhoc7inekzwc+m7voxlqy4ll k0xtpmwtao+bkyndc+zbhl2lorfr1qgbhzik0gpvchvgd2babo 0jbzvodywh7ouielrklrk227z5omlacygnxlvhrxrgc99s0pjv pc4mayabof52zmbatehekjquuy0zyj0eno7vwz0scym0ebye95 xxrhkjsfksrvtvsh2vrjkmyxxjhuszl95zgk74gnngasqiq1fy jtddnksjabq1jq1oydqapbpiqpibcixuiaafzmnno7lmnslppl kkvfrb7s5xabvjite0pxlabi0svhenrjvnd76gxljngi2ahdcz yoka4o7pckmz6uolo9prx2lh9f6+gdww21zjsdmu2ebzicst91 oxx2zxxm6v6n17s4xw3w7ajgq0cvipja/q/ojlkoikytekuobnhmnws8mvu2hnlkuvuxyk0dokwagykhfwzoj ghfxdkoa9fce2lqk3yiqhsqceiqaiqhaahceaceiqaiqhaahce aceiqaiqhaahceajcjxn1tgui7fjttxhohchkk6mwaqbccqhci bcekqbceiaeiqgd/2q== http://www.djelfa.info/vb/data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wceaakgbhqseruuehqufbuvgbuwfbqufbqufbqufrgyfbgufx qxhcyefxojgrquhy8gjccplcwsfx4xntaqnsyslckbcqokdgwo gg8pgiwchbwpkskskskpkskpkskpkskpkswpkswplckpkswpks kpkswpkskpkskpkswsnswpnskplv/aabeiaqmawgmbigaceqedeqh/xaacaaabbqebaqaaaaaaaaaaaaaeaamfbgccaqj/xabceaabawedcacfcaibbambaaabaairawqhmqusikfryxgbbh mykagxwqcjunlrfdncyokssvak4fftc6lcq2psf//eabkbaaidaqaaaaaaaaaaaaaaaaidaaeebf/eacgraaicawabawihaqaaaaaaaaabaheditfbbbiye1euimfxg zhwqv/aaawdaqaceqmrad8a0usq70rrxz334tcozedzvgrovo6e1yon3 vadz/2k5piwumc1zxbftbt4bcug1c4sdd4g/crqk7jvi5hmoehoh6x8q28r/dyahniwo1dpbrf4n4xdhxouqjomggnqflnnk6coh4hbv0x0jp/kkhyjrrozp6tvqmbrpapwovhahed6vur8qivsa8cjketmegdfr 471lqfgrt0gte0nt+f/8gd6fwltaktfxa9pbyeau6wpga64psldlnlqh0hbv4svakoq9z l4velrd2uxacb8zp5aeqetnqojzz/nqhdohnucdk4ivegystmakoqk7qfrur2iu9wz/us8fc6xuhbuf2luizsv/hpgin8slpqqnascertivwflhjdxqy1hdc7zz815m3r2szuvkt5 mhef+q28vtrammnammloaosxpcfcykfr1w0s4gctcbbbmoudh3 okue56tfqi2xucz4hioozs496pxqzuocs3qqtfcj4mkdicd6i0 ggaptcnmlpwljzcasycfrzoawpepotkwseusbmljwxjmwupspr cxtlpjsxjsbqfnpsxkpsoq9q1v+7p6t3oafreie3fdv4hwvuip eryv44rxuq9sxisogc/sj+6yqb7un+5z+ryv/cdect9fvzz7t6ktdfyurz+jf0qdptvncu62a4jizuvsh49atqz a3ociejbytnbeijuwy94pmjwbof1/khrbahne9jy0srnazf0gih1tme17cqqeymooc4vccxenvmoutk 2avabjkknjeufs6katk7gualjnia0nu2exn61l2e9gbdbrvvjv ptkwbfpu2k6hzvm7ocm0s4gf2befalc+j9lno02juxohjoc2+n gm7yqbpe9rccqcqg6mukdmab2ji4t3yqntfs6m3stc/hdr43+cdjpoxsi2fwqig5tfj6rnrktzm14valgc4bqqpbdorjg dm7arywwtha8frtpjhcnaap2gewon4iu5qoynlltmhwvwd06qc oa5jccne3giljfk5nqh9f9c6a1vcy9or+omrvaq7wmfs9k6uuh 3h4b2o0t4qoyxkppkqh7cjpv8ald5l1lvy46lmnmf1veti2gjv eitxoh05el2k+wt4dyc8co19ikz1jcykhldidhn5gfrzn7r3y6 pyuwlpogei8zcy7p5umsrsb6lhlhi9k/mshaiemdjp0/u2/kpjde6sacgfhq7sn6z0e9cg3lrehqwlvndw6xdw4roa9rxtneb i3w6fbctzoa7/afu9lgzz9jpui+m0gd3zijjcneoiemfldiqv4w3lqlsxbw3jqi litioqsdiacrne4rn88pv4tvsv7y6nskmbalgshvcrfj1n3bun i9nc6uxrrli6ans/6lwmyu4ez1wt5r4lr75rjs8lkckn2xlb2ejmy/bmmdhpfsnrywa0hqysdugrzxfaxtaja2djfcpfnvqrbadmcbta geykcumqvls5odsdilxakheny1d6mcp9i86mx7lnhvn7z3ia2r rri5t3+aibw8aadeeuypnf9rxts8gphe2evru55lxjudb/amj2hwikkjtfcsd/ahbzc6gxwpjtscb9abcemfsignrusv3q7k3wucwnspwdojbfmn 05b1nqkkujwvoptdctouoa7gdfiwvt0uztbhu0g8b4xj4uqotq wnnsegljbmdrb3ooffya4kum5jqge46luxmsm6wvms/capx1wrvxalvlp19fkfsf01n8y8ajlwupsnpfdt4bc1u0ets+7 zwhghrvq4obrcroddmuk8wsn7gde8ujateuswwxwoapddvtncx l7tve4xwih2bwcypegxkmtalg6ojgy5ptczz2j/cus0jqqflk9nfjptnueau6txzu0mh0byd3ttuzluw9xvlm4age bhez/db8cqr0wyilpbkt3ggzmvoxrgwk8pb5lseldkh2epub8vm9zgo 6hlckpy6fw1kyqwu2dng4ayfrbvarbm4btxlcjwnbefcvlibir 5ldo2wnwm0ae4bdygatxomnw3izlvqzwjythg4/rq9dkekimnz2owmwg9herhytnclxn7utogw7gni6xt4ilckijm q65cf2ioi84k5tl7l5nq0cvmkfgpdf3n+y08waxgd7gshe7ssj uwcqn0ftm03s+f0jg4r5t8vagvi8fvp3k8xissgzadou+v3kvk ow3e+f8x+i12v2twpksfys73r/ajneaktlh0gs33befmujbrcibp8adj9x8ih7x2vq1nwtnxo4jy qtsoknsmu7xjd243heugvhlnsn4bm09fep38a4dytvngpfhffm 8dnlur1czlxaacsbgajjknmg9fhwlzx1ngmbdhafgzyn/crdymh0qfwgmgcbg683qbpobkx7zwrhickrfoard5g6dmz29ez eahgmcm0cchhe74gk0zrspqukrgq3obf8wcxzstcj7jb5fsfdj 0ol9zug4ywuqdgc5u2/wjyw2lviu3spwuskppenqng6ididgmecr3oe2zxtkofawpjifs i0v2iayn934xaeczrczizdqg4aem4xenlvxpeb3o0ryrysb8ni o9jmwplzdegkrgxgngjpebbdkohj7o8vkbzpvumfhcon8eserg xax0zyeaniz8gq6dup5vgh5w4d51ojpk+mlpubugfztmx6rel2 wombsuaxqmaydlbmngi4gg7clirc+wtqn02g7dra3hfeuvz6x9 ipa97c5stbhztxeagd6zkdlpbuvdkg25iornvsb6l3u6jc1zyk hfeccmrceckulwmgnynanllz7m7y3zc5ttsf406tpmcohcohtr zbrm/gcoy0h5fx1rlletbrmvwo2ob5tf4lrw92fwmkxuawe4i7arxwc uat0h53bjrv2h3xm/c7/wdksf8ah5c/cwf6xvkh9475nezwxuwn5zuqv+z/g4pehsbiyn3fn3muzwgiec7srmmfmd9vytcvbgpkt2k7gezli6 qxusj7wjcfnc5tn6zhod4tq7i4bsxrdjh2i1bjpzas6phwt1bp mdmo2n2rwc072a5c6ugazhpvji29w24d5zj3j+gnscbpfnowdr c1uaa0sbmgdnaeacll3usomhdwzjg5uacu6bdwtp8nsepvadg1 0cje3dy3w1wzjppq1nvgxtdyklixdwaktsiqfnpn66owgfplrj hpdshag4a1ht6bukdpbxp5wyyxdriosefpa44nxmhxhbsfyra9 zh4tjhqfyldz5yc7gipkim0lzevzleukjwhmozglu1fij5kq1k rjlxlics4knvkthsa4hu1xd4fuqbiwxm9jycbxtugk8wtj2axp dgxrwnbtgrj7ivubg8nqam8atj4aivdldaxgoiyc4jwfhhg7y1 q8p6ftkz08yaypsqoc0z9nue1wiqaylz+eybtt6yuqvt+vbb1l j4djvba46gccabubpfjwjw2i5jnncic0kob1egco9d6mpghiei mtzwxlezuynl/hk5trsok6ybe8nyi71jywkyvotirufz2nrds0eyzkde4dvpgf6 zlw/oraiadhihvum+8cqyun0zciwupa5fosxtdtvvkatnmcsdzamea l5kge6npe4/hswy0zyyyscy1948/nf/iryzwpza+8qd87/wcrwkrpgbzpog7c4+qxhok4yy65/wa3/qf68qhgfyxrwi4/ve5stdixxg/6fd5t1psegphzmj2j1d1kk24vlwzsbityenkt2sdldwam7dwty 0bgtebzl7n7mhv2uodkedzcawezwuzppmtidbwobwveqjyni90 c2gremrpmlh9uebw+jvr9u9bajf4vg/g9rtkrint/mxrxfksssyddl7czpukapwosgqlk7l92zvpv+fxb4oanwbvqsb 5ycn/mvvolpz/uz+lwpfolbm+znnfpc08jd4eicn2cx3k/0nqzahd4bu+/6kilgdkhxbko2hhh7qop9dzpo2nxdytlqgps7vq5o3tie5xl7p 2kcybe4ymrrkqwq2zaesm9jhbo/m8hk/tlu9xoxupf0rrk1yvssvpp1a6rcwgc7af6wze0ricrawdehtwn v4h84zt+latxsyc2bjq4qgtetg1ktqdscx4lxcyx1jelin4cou vnuvf0z50tzvbgzjzottpglvqvek+rx2atuppxybjqc03tenxa qe/yu8mkdw0bvwvy8irrqjsickmiwjnqhvx6o6t2fgo8qpk8go9jt phnwi4vzzmga6wtbheqkirplcoy0k3kansyktrsw36stp7ww+v kowe2/wcd/wdirwqttnbjwaj5c8+syg2ukscteejvwexrsadjjvqdgfaj0tl tepnjtvep4dzkcq9pqmjajorm4wimq60jbrnsowjzrmvbcjxgf mq+ypj5dtqvikaum8tbcr3fvgtmzwor/jcsd9l2xxuajau6nzou/o1plsn5gco5awwl14djdgct2lcre+j9soscdf6gbfuzhncbhnd o4g6voiiqnkdgvna9uzbgsqscx7wukglsd0hoi6ftwe2wvdcf6 xrlg7ltqmxstmgzrve4w3wg/mi8tpkkas2rjt0c9k8qmgdtmx6bzrfegbzgllf5h6tvaagnawf xcq4ayalntdgnxjrnpteahkoqomxovajvjj260naxnpgz5l3na ast8rrgp7k5+ti5m1xxpkmsewsqgvw63njrdxqzf10id0dyddw xlcosblc2crmkbrrli9h8kcq5z33sbadzf5/mbeb3t3ouvc6kkqwj3ivhroje2m7mcddjaascnz53q6wem4ddg ban9rxdmbcbenaagycea+pnxjgb6rbfe1uzm7ygbuf7ohc8d+v mhupam4nab/8aslgvwlibtu+rqtqoaxi7anxefreujaon1tottpp/anjh+0bvoq7yrxivo9ohf5lq/wc7u81a5nddzxnzl8znuq9mdivi8dv1qcrdhkwblhmfamcs0kb ro8vemwwhboatcdiktgeb0rjrchfjjk7knnxkylpap+i/vb9ulaxuatmgbphqkmfhog/vlj0gr5tmqu/i4c3ai8ssxtjuv86a2ilnm/g5o5cxh+ivdtpzszdgq4rmtd753aebp1t9p7shsjisflpmilyn jrhevlu4heeflbssncgcqjrkotbmkdthoirqbky0frkb2mhndx ni1ft4pefvdht2drp1bdnahdw4xwvn7jn3lec3jjzmyx2dvwu6 wd+xrp8stfpntovl8etqqnikno9e+ydfdshh/hrvmbpbbxjhaxh5ok2waxndeth/zc1ygisa6x5sncgorifso7na7hnaeuej1gqbotwopz9z6uyxqz c8atns4k7szlx4q1dor11fjqwk6k8kt15jmw474lwnhoxurjdg q1zotob8rw5fy8kzudgnhkkvkkys0sdgcs4ga6hnxnfk4pq3oi tumlznyrgipdcimo9h3wejnu3pedjeajzbgc4ax5si/imffl5c4holiyaavkumr3wgncuh7whszqstcfwhtcxe4i7cdsi qyw9zkoqmmob3ha120hwi3dfqtjjklqmbfm9wtje6yrcssizef 6i3zle6oayztksxzbwadtp7mbtcpqkgxojrvmrnc1r24pa144o acpapyocdw1rs4qisnvtoltph09wxjjwnmagzfthovby34t+5p c6ctpgjkg+5uobc/bgi4keeiullhllkkm6owsh5ngtwgvkqd0o6fmtnkzjmyqq6pg5 4nxa+ey7+cqesmfsumxjlt6v2xtw0wiozsvqpc3e0umhuvuhyx xhiirsdeooxu0txxkk/dbnsve1rvcvmt7u5waynoa3gfwtan+7vqbible8kd3tcdyhiab drj8aj9p1odlw6+3nxmzrkxpijo/k0783fjbdcqbpvxk0m7nopogjykq1ooiptpbbhvehaymxo8sfv rno7jxnftxhhfwu++g8ohiebbggwxvw/qujbriuzerfuespbfujnafl6ia0cqrukeyc6booctcif5k+6hd 1k1box0szwyxmeg1wtaxzhrdwwrlzxuh11lkclfdt/uspu3uivbiivbfxb2gjapmlk8cipr9yn2ac06xf8bvub/wdapdbkqbpxd8n1/cbjwwh9d+nnrfuzrfufvhk+8bnoenjuciooyyrtvy9v1bg+vgw 368tp9nk5abw09kzknrk6ro7yn16esjtib4ovzgfbvftrfnbxc sqqdou3ky0okvolmkmlxcoulnxzovdlsg0odkla6htbmtdi8mn eboc1xj8frcl219o209lrfsgyaabb1gb6lwnpbb217pszcm8ko ljlzdfzdpmqj5ymnwnwgnkawafmjwablnfyogk0a70zs2dzkl1 7ycpmyc4elr4qm2s3obbazbgbveg8xlrcoolqrcroug7df0ejl m1kzgnnm40yw8wjsn9simt0pigpac6+vnxainuzny4dlf5wgb4 e+kzqmszul5zvym9qkz00sxibvvjgg4m+43tpfi5hvyha8loev lf11n1oyzhccyiiimcqs+q080uacwkgxhcymekztgrblqljzqn jopfh1jcvg2u6rvrhpjowqq9zlf7trsca2nhf03aipvuszhbw3 i7yadmztvormmeb7o70z07/admdlwmqb8q/av4o6ogsfenxp9xsxqm5xlcnaxg43iy8b05xbolkzsaadzjvom y+q6rc4rldzt/chipen4nyunaroqnq3ob83opwr2vbkihwxxgsj7ojzneqcdrtg tdovg9ytezkzl7axgugxjzjnyhpzk9tguswvbc9glz1dopuoe5 p4plvrpjaq5ixuimek0/ovlkv6idj7xkb42jap5x3yn1bferspp5ggr1jf1mo0ij37pnpi cbtqmft8vwn7lvua9rhnr+asd2ammbpb2cmcvdjvshpwzpz5kf xaq1scqrrv1gqhyxl0wpoqgogmweoijba0txetcn6uv+4vbkbb ka1ipk6g4xlrpsppmbpifrcp2kg0lt2k24dezt1/i+cha3tmwwwuwtiq6kjhmlzxu815zcymwkhdzvcsous8ttl3np zviptighjgyqni8ia9pm8hnn8mckl7kbxyly9t68lyxtoohaob bbegi8ehag8eplzqgnjglnbc4gruimgvfb3zxvu6w5a6qmabdp vf5h4wnxxoa5luwz4ju6qcrutr5qmsvbkkrscvgwc6rqrjl8k5 qocmml22glhwzizjcy9wqeooucns5vi5nkrw6mgcm4kw+0tkyx tn/a+qscnxh3jlouzkd08auquc8ak9c43epasr8wuo7sqotwv5jzu j+fe+fevuxkgslzqn9xckq4osmiqo3geqikzk5l7pf5lowvbnz moj3+aetecgthfwoi88t5rsfzhyq6nwj/e+kwbga5x8ws5ojsdxpmvrxsvscwcp+os7/x6tg8ytwknyeyeiayhkp9aw8xhsu/cd247l1kzjzqz4auetq5sr7bkdxth7q5pug696yslkbte5ragt dbo2/2e32kxtnoglz0islcjr6cudc1rs6owgxmawgmsteqt036huri0 cz5+y8oqq54fmmknkdwm81stycgg4xhvgqpe0axh9kgyix1ktj s62k4c72qzkoknmphrboelftfu60u4egh3ee4q0plrs8rofbbb wctlk9lvjpag59yujo6wjnmx3talug4ip2l2mw12nzren0h7d5 dwwl2hg1yycrt2u7krbui4y0du0aqiabdy1rs1kls1gc6okcee 7rgbivo1fodi2so4/wdcfmcpmxicqnwinzcpxtzfjowt2iwlqra8dbwy4c2ghxavwat owge2kyra6z20yp2vd6owfgljljumjrb2ji1hyuxtong1s1rfw kikxbqr4wyapnhph0h++izalwdddqvq1jmkubeckhmu3jlo6mh ngrklerlywm0jspftzr7toohkguklou0fcipryon5ipxb6/7rtoxqfp7y4frfsjxjfz5lpww3ifjzupfpw86kejck5qok7ifn bx0opzmtrifinrx51c7yawj2fto4lb5ksy/4fibtp0h+9s+q34v5/qzzlw5xzw7gpqmaugscsdpfklrt8afex6oz40rwkbhaesftzya cnuh+95uf0wjdzkpinmfrrnjznbp83bwy085gg4qvzyaxwosny y9p/tfqeasxtnbrpqpzbuzlxwpjxte0bztqta/ktfqolx5eqw7olas3ktr8rqi+7tslx4glakdwc3g3xbvpwrjlo vz2whcyo60mk9pe147831auq8wcn30cicpn94zcfmfuk4bbbmy 9tdp3ta7w1pnh9vmjc1p21duzdxfq8td6llgsub5gihdi1jqun z73htvw9juchrkfedillgtjsfc2g3lopu0o0sqs2rnlzjdxsvn snrqdwzoxzwzecyepld7z/yzwgcfehfjeeribalkvypne2u+7hbd5u7b4fpwr3uxwukblwfg 2vtdj5gqstijlfdheh+96ksmsmshxhiilcbkhkh1x4+intp0vv bl8fzyye5fruq7p/j2t8rlp4uwvm+dn3nftwr2guqaoqmwcwyf0mc0znkldvdm/p+qyqndgvzqnx+ao4lqolxwkylqspsls8dcoy20z69ghby4th5 oi9qibc/sany9td1zp2e+p/cu4/mcsw3izhsylrdq62i79l3dwfalbvk2qs+hy3dmggnzpcsq6tun ula4f9n1qnjckvzz2+bc2c1f8mmrg9zn3bmxx9ahx/ekznmqzn3/ijwcbtzzct8mhugp7jd/w/ppgk29x3kjycuomwgzz7am+9sx2sqdlnnpqvmdlqhtpp32u/lqjulflxkzzfkph8rekds494oju8vbgrv5llxaixa65f5ms3w1 qbnrcceddi+sdavrwlic0lrmmqrcqrgpduyntgivfebklq/8a+gwn4ar3lhk77njlt/i8x2mx0z/ckzxhc8xhk4h0qxkr0dwpknrf923ge1beweb8k7y/u28aoqethvuzbsdwula8e9rtr7juiuwzizseskbx2vfzcdjyur acfpja4vb/aor28lfstollgmr+eu/bfnlbs1gnrwo8gl6yypt92rsgei6hpumzzoktyqksb2nztly3h czipuhudfiiyvq4pvkwkk7nc08k5lexynudyyqo80txd2z1je4 dxjqyw0ygne0mjfrcdtr3mvadj48q9xvotlhr3wd3w0aefvnat 3lyy3pjlgvwtaqvmhgekb6yy7ozmjookg7zybjgz1fxz2avjap yuxdn1hb/aoqtbvozlhfsl1yfq75817yxj5nycfsropn8xrfgfct+b0tzlr fmde1zmnqsbkk5hl88awc1z2akgdgb1klvcj2eqhoozzc0vzmv aomkoyg1wudlxdic09+2ze2qp/lun1nx73/6wbntbgxxnzn+fx8wfyvu45ymprdvx+o6fpxg9lzbv9c22fo5z kci0vhocwuk03wx4izmzpzcr2jm6xsvytnrestvvgtszcw1jvl xagnmqqbjdiiae060uolj3qotwu6oeb1j4kgm4xn4nujhnix4s 0w37rsfkn6r0oqs/r+fjcbn0fc52b9ootdiy6x0ndsybm6zf2pvrkdeu3pyhb+a5zc 5s5romsjvhpwpk9rt4cbxf5m4z5hc2+qxstitj1yo8mcqn+d2h oden9ieju/kf+ohykuklvmflwxupjjzzqc2zsngfjpwt7tvbvkkkoqdt2jub ahcec8suiux7iovkpi0yjjkf+cu5nh+vt/7rp5tx0vlf7t391hjjdd03gzsnupzdpuzwb5bsffajjj3/qozrg7utpsnx+zp+r3kkkql4lmq6un/wbongqacbwpx5nvvg9ljvdvtwu/e4+assz4+/wajjcl1r+7zwknye2wnikknz+iox72xpjtzrspnj9z1nz7rssx py/l+jtdgibuajlcnl+7uklslfqqh9f7azckkoinwj4ssswgh/9k=

جميل جدّآآ ..
قوليلي بيرلا .. هذيك السنسلة تـُدعى السخآب .. يآك ؟؟
و تجي فيهآ ريحة الجآوي أو لا أدري ما هي ؟؟

تـاج الوقار
2012-02-06, 17:25

انا هناك بانتظارك لدقائق

معاً إلى الله
2012-02-06, 17:29
الله يبارك على ناسنا ههههه وعراسنا احم احم

حوحو يشكر روحو ... أحم أحم .. :1:

مرحبا بك أخي .. و أنت واش تزيد تحكيلنا على الجلفة ؟
أكيد سنسعد بمعرفة المزيد ..

اهلا بك


مرحبا بأستاذتنا الكريمة

هناك تعقيب بسيط حقيقة تختلف العادات والتقاليد حتى في المدن والقرى في حد ذاتها
نحن عندنا في البادية ليلة الفرح [ يصبح الخميس ] تلك الليلة أهل العريس يروحوا يحنوا للعروس ويأخذون معهم شات الذبيحة لنحرها يوم الخميس
يوم الجمعة صباحا يجيبوا اهل العروس القصعة [ الطعام واللحم ]
بارك الله فيك

بوركتَ أخي رابحي على الاضافة ..

اذن أنت من الجلفة ؟؟
ان كان كذلك .. فلتشاركنآ بشيء معروفة به الجلفة ..
كأكل أو صناعة او لباس .. أو أي شيء ...

أهلا بك


عطر الملكة
2012-02-06, 17:55
اختي معا الى الله
المهر عندنا راها بين 10 مليون حتى 20 و احيانا يزيد حسب الاستطاعة

اما عن السخاب

السخاب هو ذالك العقد ذو الرائحة الطيبة و الذي يصنع من مواد طبيعية 100 %
مكوناته :
* التارة : حبة كوروية الشكل ذات رائحة طيبة تباع عند العطار
* حبات طيب او ما يسمى بالقرنفل رائحته جميلة و يباع عند العطار
* العنبر طبعا غني عالتعريف
* المسك أكيد الكل يعرفه
* القمحة كمان منتوج يباع عند العطار برائحة جميلة
* السنبل يباع عند العطار
* الزابدة : كريمة بلون بني عسلي رائحتها جميلة تباع عند العطار و تستخدم كذلك كدهن للشعر و الحفاظ على جمال الشعر
* العطر الجامد عبارة عن عطر طبيعي 100 % خالي من كل الكحوليات اعتقد معروف عند اخوانا الخليجيين و اهل السعودية و يكون جامد مش سائل
التمر الجديد ** الغرس ** احد انواع التمور اللي يكو ن على شكل قالب ينظف من العلف و كل النواة اللي فيه و يعجن

بعد طحن كل هذه المواد لتصبح ناعمة تخلط مع التمر و تعجن جيدا بالعطر الجامد و الزابدة و تصبح على شكل عجينة برائحة طيبة و لون بني نقوم اخذ قطع صغيرة اقل من حبة الحمص نقوم بثقبها بواسطة ابرا و نتركها كي تنشف العجينة و تصبح قطع صلبة حينها ندخل الحبات بخيط من النوع الجيد الذي لا يقطع بسهولة كما يمكننا تزيين هذ العقد الجميل ذو الرائحة الطيبة بقطع مصنوعة من الذهب

2012-02-06, 18:16
السلام عليكم

إن شاء الله أنكم كلكم بخير .

لقد قابلة محامي هذا المساء قدمة له الملف . قال لي أنه ليس هناك مشكل .
قال لي بكل ما عندنا من إتباتات سوف نبرهن أنك كنت على حسن نية . وتريد إتمام المراسيم وكنت تحضر الزفاف . و أن البنت هي ذو سوء نية حسب مطالبها ( الفسخ و 25 مليون )

قال لي سوف نتبت بأننا المتضررين في هذه القصة . ونرفض دفع ال 25 مليون غرامة لأن ليس لها أساس.
قال لي سوف نطلب نحن إرجاع نصف صداق .

قال لي بخصوص النشوز . يجب أن البنت تكون حا ضرة و يجب أن تقول لا أرجع و قبل كل هذا النشوز يطبق علي المرأة التي قد دخلة البيت الزوجي و خرجة منه و رفضة العودة .

هذا ما عندي لحد الساعة

محمد جديدي التبسي
2012-02-06, 18:20
بارك الله فيكم
أستفيد كثيرا من تقاليد ولاية الجلفة وراني في المتابعة

البركوكس = المردود = البركوكش عندنا
الهرماس= البخسيس= الفرماس عندنا

المهر 10 ملاين مليح وفي متناول الجميع :)

زيدونا معلومات وفوائد ... في المتابعة

معاً إلى الله
2012-02-06, 18:20
اذا بقاتلك شوية لاصوص واذا عرفتي تديري نفس المقدار ربما ما تبقالكش و اذا بقات ديريها مع السباغيتي ولا المقارون و ضيفيلها لاصوص بيشاميل والبيض و الفرماج وديريهم غراتان !!!!! و اذا كنتي ما تطوليش وتديري زفيطي و خاصة في هاذ الشتا دسيهم مش مشكل ...
عجبتك الفكرة ؟؟؟

فكرة هآآآيلة >>>>>>>>>>>> :19:
سأجرّبهآ .. بصّح بيناتنآ .. فيهآ موآعن .. :1:

اخي نائل
الله يسعدك على هذ الاضافة
فعلا مثل ما تفضلتم احيانا بتكون ليلة الاربعاء الحنة و يصبح الخميس يكون العرس
و كاين ناس تدير ليلة الحنة و بعد اسبوع او احسب ما يتفاهموا يحددوا وقت آخر ليوم الزفاف
في مطلق الاحوال الليلة التي تسبق الزفاف ياخذون شات الذبيحة و معها مصروف متنوع زيت خضار علب طماطم سمنة ............................
و بخصوص صباحية يوم الجمعة
كاين الي يجيب طبق كسكس و كاين الي يجيبوا طبق شخشوخة
و ثاني الفطور نتاع الصباح
احنا ياخذوا البقلاوة و الفتات يكون محلى بالعسل و السمن و المكسرات
و طبعا هذي التفاصيل تختلف من عائلة لعائلة
شكرا على التعقيب
خالص احترامي و تقديري

و شكرآ على الاضآفات .. شوّقتونآ نحضروا عراسكم .. :mh31:


انا هناك بانتظارك لدقائق

تمّ بحمد الله ... :)

عطر الملكة
2012-02-06, 18:21
السلام عليكم

إن شاء الله أنكم كلكم بخير .

لقد قابلة محامي هذا المساء قدمة له الملف . قال لي أنه ليس هناك مشكل .
قال لي بكل ما عندنا من إتباتات سوف نبرهن أنك كنت على حسن نية . وتريد إتمام المراسيم وكنت تحضر الزفاف . و أن البنت هي ذو سوء نية حسب مطالبها ( الفسخ و 25 مليون )

قال لي سوف نتبت بأننا المتضررين في هذه القصة . ونرفض دفع ال 25 مليون غرامة لأن ليس لها أساس.
قال لي سوف نطلب نحن إرجاع نصف صداق .

قال لي بخصوص النشوز . يجب أن البنت تكون حا ضرة و يجب أن تقول لا أرجع و قبل كل هذا النشوز يطبق علي المرأة التي قد دخلة البيت الزوجي و خرجة منه و رفضة العودة .

هذا ما عندي لحد الساعة

و عليكم السلام و الرحمة و الاكرام
من الجيد انك طمئنتنا عن اخبارك
فرحتلك من كل قلبي
الله يجيب الخير كل ما قلته جيد و مبشر بالخير الحمد لله

2012-02-06, 18:38
و عليكم السلام و الرحمة و الاكرام
من الجيد انك طمئنتنا عن اخبارك
فرحتلك من كل قلبي
الله يجيب الخير كل ما قلته جيد و مبشر بالخير الحمد لله

بارك الله فيك

لا أعلم إذا البنت سوف تكون هنا عند القاضي يوم 12 .
قال لي المحامي يمكن أن تبعة القضية إلي الوقوف ف la barre .بعد الغياب المتكرر إذا غابة .
قال لي لا يمكن لي محاميها الدخول عند القاضي يوم الالإستدعاء للمكتب .

وقال لي سوف يحاسبها القاضي علي رضاها و قبولها . و لمذا تريد الأن أن لا تكمل الزفاف ؟؟؟

علي كل حال أنا طلبة من المحا مي ذكر كل أسماء من حضرو يوم الخطبة .
لا أعلم هل سيطلب منهم القاضي الحضور ليتم اليمين إذا أنكرو .

محمد جديدي التبسي
2012-02-06, 18:54
وسائل التعليم في الجزائر
https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/423160_312490092131231_100001107275006_842934_8106 0600_n.jpg

وسائل التعليم في تركيا

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/430033_312490158797891_100001107275006_842935_1567 946535_n.jpg

عطر الملكة
2012-02-06, 18:58
بارك الله فيك

لا أعلم إذا البنت سوف تكون هنا عند القاضي يوم 12 .
قال لي المحامي يمكن أن تبعة القضية إلي الوقوف ف la barre .بعد الغياب المتكرر إذا غابة .
قال لي لا يمكن لي محاميها الدخول عند القاضي يوم الالإستدعاء للمكتب .

وقال لي سوف يحاسبها القاضي علي رضاها و قبولها . و لمذا تريد الأن أن لا تكمل الزفاف ؟؟؟

علي كل حال أنا طلبة من المحا مي ذكر كل أسماء من حضرو يوم الخطبة .
لا أعلم هل سيطلب منهم القاضي الحضور ليتم اليمين إذا أنكرو .

لا تقلق طالما سلمت زمام الامور لمحامي خلاص اتركها على الله و محاميك
الله ييسر امورك

عطر الملكة
2012-02-06, 19:01
وسائل التعليم في الجزائر
https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-0921ash4/423160_31249031231_100001107275006_842934_81060600 _n.jpg

وسائل التعليم في تركيا

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/430033_312490158797891_100001107275006_842935_1567 946535_n.jpg

صحيح الفرق كبير بين الصورتين
لكن من وجهة نظري تبقى هذي الصورة احلى لانها تمثلي ذكريات طفولتي
https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/423160_312490092131231_100001107275006_842934_8106 0600_n.jpg

معاً إلى الله
2012-02-06, 19:15
اختي معا الى الله
المهر عندنا راها بين 10 مليون حتى 20 و احيانا يزيد حسب الاستطاعة

اما عن السخاب

السخاب هو ذالك العقد ذو الرائحة الطيبة و الذي يصنع من مواد طبيعية 100 %
مكوناته :
* التارة : حبة كوروية الشكل ذات رائحة طيبة تباع عند العطار
* حبات طيب او ما يسمى بالقرنفل رائحته جميلة و يباع عند العطار
* العنبر طبعا غني عالتعريف
* المسك أكيد الكل يعرفه
* القمحة كمان منتوج يباع عند العطار برائحة جميلة
* السنبل يباع عند العطار
* الزابدة : كريمة بلون بني عسلي رائحتها جميلة تباع عند العطار و تستخدم كذلك كدهن للشعر و الحفاظ على جمال الشعر
* العطر الجامد عبارة عن عطر طبيعي 100 % خالي من كل الكحوليات اعتقد معروف عند اخوانا الخليجيين و اهل السعودية و يكون جامد مش سائل
التمر الجديد ** الغرس ** احد انواع التمور اللي يكو ن على شكل قالب ينظف من العلف و كل النواة اللي فيه و يعجن

بعد طحن كل هذه المواد لتصبح ناعمة تخلط مع التمر و تعجن جيدا بالعطر الجامد و الزابدة و تصبح على شكل عجينة برائحة طيبة و لون بني نقوم اخذ قطع صغيرة اقل من حبة الحمص نقوم بثقبها بواسطة ابرا و نتركها كي تنشف العجينة و تصبح قطع صلبة حينها ندخل الحبات بخيط من النوع الجيد الذي لا يقطع بسهولة كما يمكننا تزيين هذ العقد الجميل ذو الرائحة الطيبة بقطع مصنوعة من الذهب

مممم .. اذن مزآل عندي الذاكرة .. :19:
أمّي تكسب وآحدآ .. و لآزلتُ أذكر تلك الرائحة الزكيّة فيه .. :19:

السلام عليكم

إن شاء الله أنكم كلكم بخير .

لقد قابلة محامي هذا المساء قدمة له الملف . قال لي أنه ليس هناك مشكل .
قال لي بكل ما عندنا من إتباتات سوف نبرهن أنك كنت على حسن نية . وتريد إتمام المراسيم وكنت تحضر الزفاف . و أن البنت هي ذو سوء نية حسب مطالبها ( الفسخ و 25 مليون )

قال لي سوف نتبت بأننا المتضررين في هذه القصة . ونرفض دفع ال 25 مليون غرامة لأن ليس لها أساس.
قال لي سوف نطلب نحن إرجاع نصف صداق .

قال لي بخصوص النشوز . يجب أن البنت تكون حا ضرة و يجب أن تقول لا أرجع و قبل كل هذا النشوز يطبق علي المرأة التي قد دخلة البيت الزوجي و خرجة منه و رفضة العودة .

هذا ما عندي لحد الساعة

الله المستعان أخي .. نحن معك بدعائنآ ..

بارك الله فيكم
أستفيد كثيرا من تقاليد ولاية الجلفة وراني في المتابعة

البركوكس = المردود = البركوكش عندنا
الهرماس= البخسيس= الفرماس عندنا

بالاك نشوف فيها عروسة نايلية ونتهنى ههه
المهر 10 ملاين مليح وفي متناول الجميع :)

زيدونا معلومات وفوائد ... في المتابعة

مرحبآ أخونآ محمّد ..
ننتظر أن تشاركنآ كذلك بعآدآت أهل تبسة .. :)

و سبحان الله كم تتخالف لهجآتنآ .. :1:

أتدري ما معنى فرماش عندنآ ؟؟؟


تطلق على الذي ليس لديه أسنان .. :1::1::1:

رابحي نائل
2012-02-06, 19:20
اليكم هذه الاكلة والهدية التقليدية التقتطها قبل أيام على ضفاف البادية
فحاولن التعرف عليها
الصورة تظهر وسطها بقعة صفراء هي الدهان الحر




عطر الملكة
2012-02-06, 19:21
لالا يا اختي معا الى الله
الفرماش هو صح الي ما عندوش اسنان
اما هو يقصد الفرماس بحرف السين
نظن هكذا حسب علمي

محمد جديدي التبسي
2012-02-06, 19:24
أحياناً يبدو أن الخير الذي تفعله تجاه أحدهم
غير ملحوظ .. غير مُقدر .. غير متبادل !
أو غير منتظر منك أصلاً

ذلك يجعلك تشعر بأن
... كل ما فعلته أو ستفعله
ليس له أى معنى أو قيمة

إلى أن تقرأ قول الله تعالى

<وَمَا تَفْعَلُواْ مِنْ خَيْرٍ فَإِنَّ اللَّهَ كَانَ بِهِ عَلِيما>

هنا يصبح لكل شيء قيمـــة
و ما أحلاها من قيمــــة

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/s720x720/396655_10150510077275448_521205447_9160654_1858413 830_n.jpg

معاً إلى الله
2012-02-06, 19:38
و عليكم السلام و الرحمة و الاكرام
من الجيد انك طمئنتنا عن اخبارك
فرحتلك من كل قلبي
الله يجيب الخير كل ما قلته جيد و مبشر بالخير الحمد لله

بارك الله فيك

لا أعلم إذا البنت سوف تكون هنا عند القاضي يوم 12 .
قال لي المحامي يمكن أن تبعة القضية إلي الوقوف ف la barre .بعد الغياب المتكرر إذا غابة .
قال لي لا يمكن لي محاميها الدخول عند القاضي يوم الالإستدعاء للمكتب .

وقال لي سوف يحاسبها القاضي علي رضاها و قبولها . و لمذا تريد الأن أن لا تكمل الزفاف ؟؟؟

علي كل حال أنا طلبة من المحا مي ذكر كل أسماء من حضرو يوم الخطبة .
لا أعلم هل سيطلب منهم القاضي الحضور ليتم اليمين إذا أنكرو .

لا تقلق طالما سلمت زمام الامور لمحامي خلاص اتركها على الله و محاميك
الله ييسر امورك

متآبعون بصمت .. و بدعاء في ظهر الغيب .. :)

وسائل التعليم في الجزائر
https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/423160_312490092131231_100001107275006_842934_8106 0600_n.jpg

وسائل التعليم في تركيا

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/430033_312490158797891_100001107275006_842935_1567 946535_n.jpg

اهيييييييييييه .. :1:

مالgري تو .. نحبّك يآ بلآدي ... :)

صحيح الفرق كبير بين الصورتين
لكن من وجهة نظري تبقى هذي الصورة احلى لانها تمثلي ذكريات طفولتي
https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/423160_312490092131231_100001107275006_842934_8106 0600_n.jpg

مآم أنآ ... :1:

محمد جديدي التبسي
2012-02-06, 19:40
مرحبآ أخونآ محمّد ..
ننتظر أن تشاركنآ كذلك بعآدآت أهل تبسة .. :)

و سبحان الله كم تتخالف لهجآتنآ .. :1:

أتدري ما معنى فرماش عندنآ ؟؟؟


تطلق على الذي ليس لديه أسنان .. :1::1::1:

بارك الله فيك اختي الفاضلة "معا إلى الله"
الفرماس بال "س" عندنا
الفرماش = الرجل الذي ليس له أسنان = الدريد باللغة العربية

في خصوص تقاليد ولاية تبسة
لا أعرف الكثير حول الأعراس
ولا أحب الذهاب إليها بتاتا وإن شاء الله سأوافيكم بما أعرفه في حينه بإذن الله
شكرا أختي عطر بارك الله فيك وربي يحفظك

بارك الله فيكم ووفقكم لكل خير
والسلام عليكم ورحمة الله وبركاته

2012-02-06, 19:55
اليكم هذه الاكلة والهدية التقليدية التقتطها قبل أيام على ضفاف البادية
فحاولن التعرف عليها
الصورة تظهر وسطها بقعة صفراء هي الدهان الحر




السلام عليكم
نشكرك على الهدية
و بصحتكم طبعا .. فهي أكلة تليق بالأجواء الباردة
على حد علمي هي أكلة تدعى " المقطيعة"
و ان كانت الاجابة صحيحة سأعود لاخبركم بكيفية اعدادها

2012-02-06, 20:04
وكأنه ملتقى لنشر عاداتنا وتقاليدنا وما اروعكم؟؟ حقيقة شرفتمونا بتواضعكم واخلاقكم وحسن نياتكم وطيبة قلوبكم وصفاء سرائركم ونقاء افكاركم فتحية اكبار وتقدير لكل من ساهم ويساهم في نشر الفائدة والاستفادة وحقيقة والحق يجب ان يقال شكرناكم مرارا وتكرارا فانتم اهل للشكر وتستحقون اكثر من ذلك .... ولتسمح لي الاخت معا صاحبة الموضوع ان اتقدم بعظيم الشكر والتقدير لكل الاعضاء الفاعلين في الخيمة عامة وفي هذا الموضوع خاصة على الجهوذ الذي تبذلونها والتي اثرت الموضوع واعطته اللمسة الجمالية التي اقشعر منها بدني لما فيها من انفتااااااااح للقلووووووووووووب حقيقة والله ......
لاأعتقد أن اكثر المتفائلين كان يتوقع ان نصل الى هذا العدد من المشاركات والمشاهدات والكل قال موضوع فيه دردشة ومصيره الغلق بعد " صفحات من المشاركات ....
يالها من جهود تقدمونها لرقي المنتدى عامة
يالها من بيئة خصبة ساعدتنا وساعدتكم على المضي قدما والتواصل والمواصلة .......
ياله من حب تقدمونه لمنتداكم ........
جمعنا حب المنتدى فتوجنا بذلك بالنجاح ومن نجاح الى نجاح باذن الله ورغم انوف الحاسدين المثبطين .....
كسبنا اخوة واخوات واصدقاء لم تلدهم امهاتنا .....
بنينا بيتا في كل مدينة وفي كل قلب .....

اخوتي الكرام ان لكم الفضل بعد الله سبحانه وتعالى في رقي منتدانا ووصوله الى القمة

معا .......بيرلا ........عطر الملكة ......محمد ....... التبسي ......... والبقية جزيتم خيرا وبارك الله فيكم ووفقكم في امور دينكم ودنياكم طبتم وطاب ممشاكم وتبواتم من الجنة مقعدا
انتم مبدعون انتم متميزون انتم خلاقون انتم كل شيء ايجابي

كمال الاسلام
2012-02-06, 20:05
نصيحة ^_^

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/s320x320/423300_249582495115940_100404203367104_557570_6227 05658_n.jpg

عندما يطلب منك شخص ان تختار هدية فختر دائما الاجمل والاروع

لانه قد تقع في هذا الموقف

أصطحبها معه لمحل الهدايا

و قال لها :
أريد أن تختاري لأمي هدية من ذوقك

شعرت بالغيره بداخلها
أختارت أقل هدية قيمة
و شكل و قام هو بتغليفها

و بالمساء أتى إلى زوجته
و قدم لها الهدية التي أشترتها
و أخبرها :
أني أحببت أن تشترين هديتك
بنفسك لتكون كما تحبينها

أصيبت بـ أحباط لأنها لو أحبت لغيرها
ما تحب لنفسها لكانت هديتها أجمل
" و على نيتكم ترزقون "

محمد جديدي التبسي
2012-02-06, 20:20
بارك الله فيك أخي الفاضل "مصطفى"
وفقك الله لكل خير
نسأل الله أن يرزقنا الإخلاص في القول والعمل
وأن يديم المحبة بيننا "محبة في الله"
والشكر موصول لكل أهل الدار وأخص بالذكر صاحبة القلب الكبير
الأخت "معا إلى الله"
وكل الإخوة أهل الجلفة أهل الكرم والجود "بيرلا وعطر الملكة وراوية"
ووالأخ سفيان والأخت ستار والأخ عقبة وكل من شارك ولو بكلمة

وبإذن الله معا جميعا إلى جنات عدن رفقة الحبيب صلى الله عليه وسلم
المهم أخلصوا النيات وتوكلوا على الله ولتكن الكلمة الطيبة والمعاملة الحسنة والتناصح في الخير هو العنوان

بارك الله فيكم ووفقكم لكل خير وأعطاكم من خيري الدنيا الآخرة
والسلام عليكم ورحمة الله وبركاته

رابحي نائل
2012-02-06, 20:31
السلام عليكم
نشكرك على الهدية
و بصحتكم طبعا .. فهي أكلة تليق بالأجواء الباردة
على حد علمي هي أكلة تدعى " المقطيعة"
و ان كانت الاجابة صحيحة سأعود لاخبركم بكيفية اعدادها

وعليكم السلام
لم أسمع " المقطيعة" في لهجتنا وفي اكلاتنا
ممكن توضيح وإفادة
اما عن هذا الطبق السابق ذكره نترك الاخوات التعرف عليه ويفدنا كيف تحضيره
حقيقة هو طبق شهي جدا
شكرا راوية على المتابعة

معاً إلى الله
2012-02-06, 20:34
اليكم هذه الاكلة والهدية التقليدية التقتطها قبل أيام على ضفاف البادية

فحاولن التعرف عليها
الصورة تظهر وسطها بقعة صفراء هي الدهان الحر




هل ي شخشوخة الظفر يآ ترى ؟؟؟؟ :rolleyes:

لالا يا اختي معا الى الله
الفرماش هو صح الي ما عندوش اسنان
اما هو يقصد الفرماس بحرف السين
نظن هكذا حسب علمي

ايه علابالي انو قال فرماس .. لكن أنا ظحكت كي قريتهآ ..
لأنو واحد لسلوس يقول للفرماش .. فرمآس .. :1:

أمزح فقط ..

أحياناً يبدو أن الخير الذي تفعله تجاه أحدهم
غير ملحوظ .. غير مُقدر .. غير متبادل !
أو غير منتظر منك أصلاً

ذلك يجعلك تشعر بأن
... كل ما فعلته أو ستفعله
ليس له أى معنى أو قيمة

إلى أن تقرأ قول الله تعالى

<وَمَا تَفْعَلُواْ مِنْ خَيْرٍ فَإِنَّ اللَّهَ كَانَ بِهِ عَلِيما>

هنا يصبح لكل شيء قيمـــة
و ما أحلاها من قيمــــة

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/s720x720/396655_10150510077275448_521205447_9160654_1858413 830_n.jpg

و نعمة بالله .. و مآ أسعدنآ بربٍّ لآ يضيع الأجر عنده ..
ياك يقولك .. دير الخير و انساه ..
بصحّ ربي ما ينساهش ..

و لي دار الخير .. عمروا ما يضيع مفعولوا ..

شكرآ أخونا محمّد .. :mh31:

بارك الله فيك اختي الفاضلة "معا إلى الله"

الفرماس بال "س" عندنا
الفرماش = الرجل الذي ليس له أسنان = الدريد باللغة العربية

في خصوص تقاليد ولاية تبسة
لا أعرف الكثير حول الأعراس
ولا أحب الذهاب إليها بتاتا وإن شاء الله سأوافيكم بما أعرفه في حينه بإذن الله
شكرا أختي عطر بارك الله فيك وربي يحفظك

بارك الله فيكم ووفقكم لكل خير
والسلام عليكم ورحمة الله وبركاته

آآآه .. تقصد الفرماش باللغة العربية هو الدريد ؟؟
لم أكن أعرفهآ .. مليح تعلّمتُ أمر ..
و ماذا نقول عن المرأة الفرماشة ؟ .. الدرداء ؟؟ :rolleyes:


مش شرط تحكيلنا على الاعراس و مجرياتهآ ..
لكن احكيلنا على تبسة عموما ..

باش معروفة .. و واش الحاجة لي تميّزكم عن باقي المدن .. :)

السلام عليكم

نشكرك على الهدية
و بصحتكم طبعا .. فهي أكلة تليق بالأجواء الباردة
على حد علمي هي أكلة تدعى " المقطيعة"
و ان كانت الاجابة صحيحة سأعود لاخبركم بكيفية اعدادها

و عليكم السلام و رحمة الله و بركآته ..

مرحبآ راوية .. :)
مآم لو كآنت اجابتكِ خاطئة .. نريد الوصفة تاع هذه الأكلة التي ذكرتي .. :1:.. ما عندك وين تروحي .. :19:

2012-02-06, 20:35
السلام عليكم و رحمة الله و بركاته

أولا أود أن أشكر الأخت الكريمة على الموضوع و الشكر موصول لكل من ساهم في اثرائه

بارك الله فيكم

الطبق هو اما -مقطيعة أو -فتات

أما عن طريقة تحضير المقطيعة يا ريت تقدميهالنا من فضلك عزيزتي راوية

2012-02-06, 20:45
السلام عليكم
أخ نائل
يعني اجابة خاطئة:mad: .. سأنتظر الأخوات
المقطيعة لا أدري ربما لها تسميات أخرى و لا أعلمها

أوافقك الرأي ان لم تكن مقطيعة فهي " فتات "

معا إلى الله

سأوافيك بالوصفة .. مانيش معولة نهرب:1:
وقبل هذا سأستفسر عنها جيدا .. لأني لم أعدها من قبل

رابحي نائل
2012-02-06, 20:45
[QUOTE=معاً إلى الله;8786234]

هل ي شخشوخة الظفر يآ ترى ؟؟؟؟ :rolleyes:

وهذه أيضا لم نسمع بها في لهجتنا
أمممممممممم يا هل ترى ماهي شخشوخة الظفر اول مرة أسمع بهذا الاسم
بارك الله في الجميع

محمد جديدي التبسي
2012-02-06, 20:45
[quote=معاً إلى الله;8786234]

هل ي شخشوخة الظفر يآ ترى ؟؟؟؟ :rolleyes:

ايه علابالي انو قال فرماس .. لكن أنا ظحكت كي قريتهآ ..
لأنو واحد لسلوس يقول للفرماش .. فرمآس .. :1:

أمزح فقط ..

و نعمة بالله .. و مآ أسعدنآ بربٍّ لآ يضيع الأجر عنده ..
ياك يقولك .. دير الخير و انساه ..
بصحّ ربي ما ينساهش ..

و لي دار الخير .. عمروا ما يضيع مفعولوا ..

شكرآ أخونا محمّد .. :mh31:

آآآه .. تقصد الفرماش باللغة العربية هو الدريد ؟؟
لم أكن أعرفهآ .. مليح تعلّمتُ أمر ..
و ماذا نقول عن المرأة الفرماشة ؟ .. الدرداء ؟؟ :rolleyes:


مش شرط تحكيلنا على الاعراس و مجرياتهآ ..
لكن احكيلنا على تبسة عموما ..

باش معروفة .. و واش الحاجة لي تميّزكم عن باقي المدن .. :)

بارك الله فيك أيتها الذكية فعلا
هو أدرد أو دريد وهي درداء

فيما يخص تبسة وتقاليدها بإذن الله

بارك الله فيك وربي يحفظك ودمتم سالمين
والسلام عليكم ورحمة الله وبركاته

معاً إلى الله
2012-02-06, 20:53
وكأنه ملتقى لنشر عاداتنا وتقاليدنا وما اروعكم؟؟ حقيقة شرفتمونا بتواضعكم واخلاقكم وحسن نياتكم وطيبة قلوبكم وصفاء سرائركم ونقاء افكاركم فتحية اكبار وتقدير لكل من ساهم ويساهم في نشر الفائدة والاستفادة وحقيقة والحق يجب ان يقال شكرناكم مرارا وتكرارا فانتم اهل للشكر وتستحقون اكثر من ذلك .... ولتسمح لي الاخت معا صاحبة الموضوع ان اتقدم بعظيم الشكر والتقدير لكل الاعضاء الفاعلين في الخيمة عامة وفي هذا الموضوع خاصة على الجهوذ الذي تبذلونها والتي اثرت الموضوع واعطته اللمسة الجمالية التي اقشعر منها بدني لما فيها من انفتااااااااح للقلووووووووووووب حقيقة والله ......
لاأعتقد أن اكثر المتفائلين كان يتوقع ان نصل الى هذا العدد من المشاركات والمشاهدات والكل قال موضوع فيه دردشة ومصيره الغلق بعد " صفحات من المشاركات ....
يالها من جهود تقدمونها لرقي المنتدى عامة
يالها من بيئة خصبة ساعدتنا وساعدتكم على المضي قدما والتواصل والمواصلة .......
ياله من حب تقدمونه لمنتداكم ........
جمعنا حب المنتدى فتوجنا بذلك بالنجاح ومن نجاح الى نجاح باذن الله ورغم انوف الحاسدين المثبطين .....
كسبنا اخوة واخوات واصدقاء لم تلدهم امهاتنا .....
بنينا بيتا في كل مدينة وفي كل قلب .....

اخوتي الكرام ان لكم الفضل بعد الله سبحانه وتعالى في رقي منتدانا ووصوله الى القمة

معا .......بيرلا ........عطر الملكة ......محمد ....... التبسي ......... والبقية جزيتم خيرا وبارك الله فيكم ووفقكم في امور دينكم ودنياكم طبتم وطاب ممشاكم وتبواتم من الجنة مقعدا
انتم مبدعون انتم متميزون انتم خلاقون انتم كل شيء ايجابي

مآ عسانا نقول بعد هذه الكلمات الجميلة ..
مآ عسآنآ نضيف بعد هذآ الاطراء العظيم ..
قد أكون أتهرّب من المجاملات و الاطراءات عن فكرة الموضوع ..
لكن أضمّ صوتي لصوتك أخي الكريم مصطفى ..
و أثني على الجهود المبذولة لاخواننا و أخواتنا ..
كل واحد باسمه ..
فنجاح الموضوع ساهم فيه الكثير و الكثير ..

فعلى بفضل هذا الموضوع كسبنا اخوة و أخوات و أصدقاء و صديقات
لا يقدّروا بثمن ..

نكاد كلّنا نتشابه في العديد من الأمور العامة أو الخاصة ..

اندمجنا بكلّ بساطة .. و تفاعلنا بكلّ طلاقة ..
و كأننا نعرف بعضنا البعض منذ الصغر ..

أتعرف لما نجحنا في هذا الاندماج ؟
لأننا نحمل قلوبا صافيا .. لأن كلّ واحد فينا .. بمجرّد دخوله لهذى الموضوع .. الدار داركم ..
ينسى همومه و قلقه و أتعابه ..

هنآ يجد المرء نفسه في عالم من الأمان رفقة صحبة طيّبة ..

كنتُ أحيانا اخاف ان يغيض الحال واحد علنا ..
حين ننصحه أو ننبّهه ..

لكن وجدتُ أنّ القلوب التي اجتمعت هنا .. قد اجتمعت على الحب في الله حقآ ..

أنا شخصيا تعلّمت كثير من الأمور معكم ..
و استفدت الكثير و الكثير ..
و أطمح لأكثر من كثير ..


بلآغ من وزآرة الشؤون المنزلية .. :1:

الدآر دآركـــم .. منكم و اليكم ..
ترحّب بكم و تسعد بلقيآكم ..


نرمي إلى كآفة أهل الدآر ..
مشآركين و مرآقبين و زوّآر ..
أنّنآ نستقبلهم دومآ بالورود والأزهآر ..
و نفرح بمشآركآتهم ليلآ و نهآر ..
و نقرؤهآ بفرحة و شوقٍ كبآر ..
هنآ اجتمعنآ كبآرآ و صغآر ..
على المحبّة التقينآ و في الموآضيع كآن لنآ حوآر ..
جمعنآ الاحترآم في هذه الدآر ..
و ابتعدنآ فيهآ عن أجوآء الشجآر ..
تقآسمنآ بدآخلهآ الحلو و الـمَرآر ..
و كآن الصبر و المتعة و الفائدة لنآ شعآر ..
فهلمّوا نفيد و نستفيد و نكون من الأبرآر ..
و لتحتسبوا اجر عملكم و نيتكم عند الله الغفآر ..

هذه أنآ أختكم [ معآ إلى الله (http://www.djelfa.info/vb/member.php?u=341889) ] يآ أطهآر ..
أمدّ يدي لكم و أدعوكم لأن تحسنوا القرآر ..
في الاعتناء بدآرنآ و جعلهآ من الأخيار ..
مهمآ أثنيتُ عليكم .. لن أوفكم حقّكم يآ معشر الدآر ..

كونوا بألف خير ..
و أفيدوا و استفيدوا تنآلوا الأجر ..

◄ تـفـضـلـوا مـرحـبآ بالجـميــع ... ♥ الــدآر دآركــم ♥ ... دردشـة مـنـكـم و إلـيـكـم ► (http://www.djelfa.info/vb/showthread.php?t=836791)

المشآركين ..

المشآركآت : 1806
مشاهدات : 16301
سآ 21.52

سلامي و تقديري للجميــــع ..


2012-02-06, 20:58
د.سلمان بن فهد العوده

الطفل يرى منزله الحقيقي حيث يجتمع والداه، وما سواه مزار !.

معاً إلى الله
2012-02-06, 21:02
نصيحة ^_^

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/s320x320/423300_249582495115940_100404203367104_557570_6227 05658_n.jpg

عندما يطلب منك شخص ان تختار هدية فختر دائما الاجمل والاروع

لانه قد تقع في هذا الموقف

أصطحبها معه لمحل الهدايا

و قال لها :
أريد أن تختاري لأمي هدية من ذوقك

شعرت بالغيره بداخلها
أختارت أقل هدية قيمة
و شكل و قام هو بتغليفها

و بالمساء أتى إلى زوجته
و قدم لها الهدية التي أشترتها
و أخبرها :
أني أحببت أن تشترين هديتك
بنفسك لتكون كما تحبينها

أصيبت بـ أحباط لأنها لو أحبت لغيرها
ما تحب لنفسها لكانت هديتها أجمل
" و على نيتكم ترزقون "

بارك الله فيك أخونى الكريم كمال ..
فعلا و الله هذه القصة عبرة لمن يعتبر ..

لا أعلم علاش بعض النساء لا يحبن حماتهنّ .. و لما بعض الحموات لا يحبن عرائسهنّ .. :1:

زعمة لوكان جآءت الحالة عكسية .. مآذى كانت ستختار الحماة لكنّتهآ .. ؟؟ :rolleyes:

الله يهدينا و يصلح أحوالنا و يرضينا بالشيء لي عندنا ..

سلامي أخي الكريم .. لا تغب طويلا عن الدار .. فهي دآركــــــــم .. :)

بارك الله فيك أخي الفاضل "مصطفى"

وفقك الله لكل خير
نسأل الله أن يرزقنا الإخلاص في القول والعمل
وأن يديم المحبة بيننا "محبة في الله"
والشكر موصول لكل أهل الدار وأخص بالذكر صاحبة القلب الكبير
الأخت "معا إلى الله"
وكل الإخوة أهل الجلفة أهل الكرم والجود "بيرلا وعطر الملكة وراوية"
ووالأخ سفيان والأخت ستار والأخ عقبة وكل من شارك ولو بكلمة

وبإذن الله معا جميعا إلى جنات عدن رفقة الحبيب صلى الله عليه وسلم
المهم أخلصوا النيات وتوكلوا على الله ولتكن الكلمة الطيبة والمعاملة الحسنة والتناصح في الخير هو العنوان

بارك الله فيكم ووفقكم لكل خير وأعطاكم من خيري الدنيا الآخرة
والسلام عليكم ورحمة الله وبركاته

و الله دون مجاملة و لا مبالغة ..
فانت يا أخي الكريم محمّد .. من الفاعلين في هذا الموضوع ..
فلا يمرّ يوم منذ افتتاح الدار .. الا و أنت متواجد فيها .. تفيد و تستفيد و تشكر .. و تشجع ..

114 مشاركة ما شاء الله كلها فائدة و منفعة و تذكير ..

باركك المولى و رزقك من حيث لا تحتسب .. و أقرّ عينك بما تتمنى ان شاء الله ..
و ثبّت أجرك في ميزان حسناتك ياااا رب ...

و الشكر موصول لكلّ الاخوة و الأخوات الفاعلين و الفاعلات ..

لكم مني أطيب و أجمل تحيّة ..

دمتم معطآئين و للخير سبّآقين و للأجر جامعين ..


وعليكم السلام

لم أسمع " المقطيعة" في لهجتنا وفي اكلاتنا

ممكن توضيح وإفادة
اما عن هذا الطبق السابق ذكره نترك الاخوات التعرف عليه ويفدنا كيف تحضيره
حقيقة هو طبق شهي جدا
شكرا راوية على المتابعة

و انا لم أسمع بالمقيطعة كذلك ... :rolleyes:
سبحان الله لهجآت الجزائر تتعدّد بشكل كبير ..


2012-02-06, 21:08
يا اهل الدر تحية اجلال واكبار
تقول صاحبة الدار
عليكم بتبادل الافكار
وتجنبوا الدردشة والتكرار
وتعاونوا بدون شجار
ومتعونا بكل مالديكم من اسرار
الله يبعد علينا الاشرار
ويقرب الينا الاخيار

محاولة الاخت معا ماتضحكييييش علينا ههه

معاً إلى الله
2012-02-06, 21:14
السلام عليكم و رحمة الله و بركاته

أولا أود أن أشكر الأخت الكريمة على الموضوع و الشكر موصول لكل من ساهم في اثرائه

بارك الله فيكم

الطبق هو اما -مقطيعة أو -فتات

أما عن طريقة تحضير المقطيعة يا ريت تقدميهالنا من فضلك عزيزتي راوية

و عليكم السلام و رحمة الله و بركآته ..

أهلآ و سهلا بالضيفة الجديدة ..

مرحبا بيك .. جوزي تفضلي .. الدار دااااارك .. :)

أتمنى لكِ يا أختي الكريمة اقامة طيبة معنا و بيننا ..
و نتمنى لكِ المتعة و الفائدة ..

كوني بألف خير ..


السلام عليكم

أخ نائل
يعني اجابة خاطئة:mad: .. سأنتظر الأخوات
المقطيعة لا أدري ربما لها تسميات أخرى و لا أعلمها

أوافقك الرأي ان لم تكن مقطيعة فهي " فتات "

معا إلى الله

سأوافيك بالوصفة .. مانيش معولة نهرب:1:
وقبل هذا سأستفسر عنها جيدا .. لأني لم أعدها من قبل

أكي .. و هو كذلك .. :19:

قوليلي .. تسمعي بشخشوخة الظفر ؟
أظنهآ هي .. :rolleyes:

[QUOTE=معاً إلى الله;8786234]

هل ي شخشوخة الظفر يآ ترى ؟؟؟؟ :rolleyes:

وهذه أيضا لم نسمع بها في لهجتنا
أمممممممممم يا هل ترى ماهي شخشوخة الظفر اول مرة أسمع بهذا الاسم
بارك الله في الجميع

شخشوخة الظفر .. أنا سمعت بلي القسنطينين هم لي معروفين بيها ..

و أنا لا اعرف تحضيرها .. لكن أكلتها مرّة ..

شوف >>> عمّك قوقل يعرفهآ .. :1:
http://www.google.com/search?tbm=isch&hl=fr&source=hp&biw=1016&bih=478&q=%D8%B4%D8%AE%D8%B4%D9%88%D8%AE%D8%A9+%D8%A7%D9%8 4%D8%B8%D9%81%D8%B1&gbv=2&oq=%D8%B4%D8%AE%D8%B4%D9%88%D8%AE%D8%A9+%D8%A7%D9% 84%D8%B8%D9%81%D8%B1&aq=f&aqi=&aql=&gs_sm=e&gs_upl=8890l8968l0l9015l12l1l0l0l0l0l0l0ll0l0


بارك الله فيك أيتها الذكية فعلا

هو أدرد أو دريد وهي درداء

فيما يخص تبسة وتقاليدها بإذن الله

بارك الله فيك وربي يحفظك ودمتم سالمين
والسلام عليكم ورحمة الله وبركاته

أيآ مليح .. قلتهآ زهر .. :1:
و في انتظآر شيء نتعرّف به أكثر على ولاية التبسة ..

جميل أن نتعرّف على كلّ ولاية بطريقة خاصة ..
فاليوم تكلّمنا عن الجلفة .. و أكيد سنتكلّم عنها كثيرا ..

كما سنتكلّم عن تبسة .. و الولايات الاخرى ان شاء الله

تقبلوا سلامي و احترامي .. دمتم طيبين .. :mh31:

[QUOTE=MATRIX-DZ;8786640]د.سلمان بن فهد العوده

الطفل يرى منزله الحقيقي حيث يجتمع والداه، وما سواه مزار !.

مرحبآ أخونآ متريكس ..
و الله صدق الدكتور ..

و بوركت على هذه المقولة ..

أهلا بك .. نورت .. :mh31:

2012-02-06, 21:21
تابعت مشاركات هذا اليوم ..

وجدت أن أغلبها تتكلم عن نقطة ضعفي :o

أتتكلمون عن الشخشوخة وأنا هنا بينكم !!

لا حول ولا قوة الا بالله

ألا تعلمون ما مدى تأثير مثل هذه المواضيع علي ؟؟

وما زاد الطين بلة

تتلكمون عن المهراس وما ينتج عنه من الزفيطي ومشتقاته ؟؟

لا حول ولا قوة الا بالله ..

وهذه تتكلم عن البركوكس وأخرى عن الكسكسي وأخرى عن المردود !!

تتكلمون ودون مراعاة لتأثر المتابعين لمثل هذه المأكولات ..

كل الكلام عن الأكلات قد نتجاوز عنه و" نديرو رواحنا ما شفناش "

ولكن الكلام عن الشخشوخة وفي ذاك التوقيت ؟؟؟

لا حول ولا قوة الا بالله ..

لقد بدأت مصاريني تتلوى من الجوع عندما ذكرت الشخشوخة

كنت في حالة يرثى لها




وبينما أنا في تلك الحالة






هل تعلمون ماذا حدث





دخلت علي الوالدة أكرمها الله بطبسي شخشوووخة http://up.arabsgate.com/u/9320/5333/83912.gif

ففرحت كثيييرا بهذه المفاجأة الساااارة
وحمدت الله كثيرا

ثم قررت أن أعفو وأسامح الأخوات الطيبات على ما فعلنه بنا اليوم :)







ربي يحفظكن ويبارك فيكن
ودمتن طيبات سالمات كريمات طاهيات ماهرات

ويحفظ جميع الإخوة الكرام وكل من مر على دارنا الجميلة

جزاكم الله خيرا

2012-02-06, 21:22
[quote=معاً إلى الله;8786234]

هل ي شخشوخة الظفر يآ ترى ؟؟؟؟ :rolleyes:

وهذه أيضا لم نسمع بها في لهجتنا
أمممممممممم يا هل ترى ماهي شخشوخة الظفر اول مرة أسمع بهذا الاسم
بارك الله في الجميع

السلام عليكم

هل هو الفتات؟؟؟

معاً إلى الله
2012-02-06, 21:22
يا اهل الدر تحية اجلال واكبار
تقول صاحبة الدار
عليكم بتبادل الافكار
وتجنبوا الدردشة والتكرار
وتعاونوا بدون شجار
ومتعونا بكل مالديكم من اسرار
الله يبعد علينا الاشرار
ويقرب الينا الاخيار

محاولة الاخت معا ماتضحكييييش علينا ههه

مليح وآصل ... ^^

أتدري ؟؟ .. الشيء الجميل الذي يعجبني في هذه الدآر الافتراضية ..
انّهآ كما قالت أختي بيرلا مرّة من المرآت .. منتدى في حد ذاته ..

فلنا مشاركات من نوع الخواطر .. و أخرى من اللهجآت ..
و أخرى تخصّ الديكور .. و أخرى الصور ..
و أخرى الدين .. و أخرى المجتمع ..
و أخرى الأشغال اليدويّة .. و أخرى الطبخ ..

..... الخ ..

بالمختصر المفيد .. لي يدخل هنا نقول له :

الدآر دآركم .. مش حتقدر تغمّض عينيك .. :1:


شكرآ أخي مصطفى على المحاولة .. :)


2012-02-06, 21:23
أكي .. و هو كذلك .. :19:

قوليلي .. تسمعي بشخشوخة الظفر ؟
أظنهآ هي .. :rolleyes:

شخشوخة الظفر .. لم أسمع بها من قبل
و حسب الصور التي أدرجتها ليست هي

صراحة فضولي يزداد لمعرفة أكلة الأح نائل

رابحي نائل
2012-02-06, 21:33
[quote=رابحي نائل;8786423]

السلام عليكم

هل هو الفتات؟؟؟
وعليكم السلام
شكرا على المتابعة والاهتمام
نعم هو الفتات بعينه
ولكن رغبة في التواصل في الدار أردت ان أعرف ما يسميه البعض
وكيفية تحضيره
شكرا راوية وأميمة ومعا الى الله على الرغبة الى المعرفة وشكرا للجميع
بارك الله في الجميع

معاً إلى الله
2012-02-06, 21:34
تابعت مشاركات هذا اليوم ..

وجدت أن أغلبها تتكلم عن نقطة ضعفي :o

أتتكلمون عن الشخشوخة وأنا هنا بينكم !!

لا حول ولا قوة الا بالله

ألا تعلمون ما مدى تأثير مثل هذه المواضيع علي ؟؟

وما زاد الطين بلة

تتلكمون عن المهراس وما ينتج عنه من الزفيطي ومشتقاته ؟؟

لا حول ولا قوة الا بالله ..

وهذه تتكلم عن البركوكس وأخرى عن الكسكسي وأخرى عن المردود !!

تتكلمون ودون مراعاة لتأثر المتابعين لمثل هذه المأكولات ..

كل الكلام عن الأكلات قد نتجاوز عنه و" نديرو رواحنا ما شفناش "

ولكن الكلام عن الشخشوخة وفي ذاك التوقيت ؟؟؟

لا حول ولا قوة الا بالله ..

لقد بدأت مصاريني تتلوى من الجوع عندما ذكرت الشخشوخة

كنت في حالة يرثى لها




وبينما أنا في تلك الحالة






هل تعلمون ماذا حدث





دخلت علي الوالدة أكرمها الله بطبسي شخشوووخة http://up.arabsgate.com/u/9320/5333/83912.gif

ففرحت كثيييرا بهذه المفاجأة الساااارة
وحمدت الله كثيرا

ثم قررت أن أعفو وأسامح الأخوات الطيبات على ما فعلنه بنا اليوم :)







ربي يحفظكن ويبارك فيكن
ودمتن طيبات سالمات كريمات طاهيات ماهرات

ويحفظ جميع الإخوة الكرام وكل من مر على دارنا الجميلة

جزاكم الله خيرا

مرحبآ بأخونآ الكريم ابن الكرماء .. [ سعيد ] .. :mh31:
و هآ نحن و لله الحمد .. كنّآ سببآ في التلميح للأكلات المفضّل لديك ..

و تحقّق لك اكلهآ حقيقةً .. :1:

مش كما حنا .. من الصباح و حنا نطمعوا في رواحنا ..
و نشهيو في بطوننا مع الأخير ما صاحنا والو .. http://www.djelfa.info/vb/images/icons/456ty.gif

الله يبارك لك في الوالدة الكريمة ..
و يحفظهالك و يرضيها عليك ..

و اذا كاش ما تشهيت .. رانا هنا .. قول برك ..
نديرو عليه موضوع .. و بعد لحظآت ستدخل عليك الوالدة بالطبق .. :1:

ربي يحفظك أخي الكريم ..
و هآ انآ ذي أهديك .. طبقي المفضّل ... :)

http://sphotos.ak.fbcdn.net/hphotos-ak-sjc1/hs384.snc3/23466_108293475877504_100000905560131_57982_339288 _n.jpg



2012-02-06, 21:34
المشاركة الأصلية كتبت بواسطة رابحي نائل http://www.djelfa.info/vb/images/buttons/viewpost.gif (http://www.djelfa.info/vb/showthread.php?p=8784876#post8784876)
اليكم هذه الاكلة والهدية التقليدية التقتطها قبل أيام على ضفاف البادية

فحاولن التعرف عليها
الصورة تظهر وسطها بقعة صفراء هي الدهان الحر

http://www.djelfa.info/vb/images/statusicon/wol_error.gifإضغط هنا لرؤية الصورة بحجمها الطبيعي.http://www8.0zz0.com/2012/02/06/19/490638259.jpg

http://www.djelfa.info/vb/images/statusicon/wol_error.gifإضغط هنا لرؤية الصورة بحجمها الطبيعي.http://www8.0zz0.com/2012/02/06/19/984079477.jpg

http://www.djelfa.info/vb/images/statusicon/wol_error.gifإضغط هنا لرؤية الصورة بحجمها الطبيعي.http://www12.0zz0.com/2012/02/06/15/483338067.jpg

السلام عليكم
الله الله مكانش فيكم اللي يعرف يعرض؟؟؟؟ تاكلوا وحدكم ؟؟؟
أظن انها المقطيعة كما أشارت الأخت رواية

عطر الملكة
2012-02-06, 21:36
امممممممممممممممم انا التزمت الصمت لاني حرت فيها
حتى الوالدة حارت فيها
طلعت اخر شي فتات
يلا مش مشكل بصحتكم

عِقْدُ اليَاسَمِينْ
2012-02-06, 21:39
خويا رابحي والله ماحقت تسخفنا


2012-02-06, 21:42
السلام عليكم
نعم هو الفتات بعينه
و أخيرا ... عموما من خلال الصور هو مختلف تماما عن الفتات الذي نعده نحن
هناك عدة طرق لأعداده .. التقليدي
و الآخر الذي يسقى بالعسل و المكسرات
بارك الله فيك أخ نائل
هنيئا لكم

أظن انها المقطيعة كما أشارت الأخت رواية
و أخيرا احدهم يعرف المقطيعة :1:

معاً إلى الله
2012-02-06, 21:43
[quote=رابحي نائل;8786423]

السلام عليكم

هل هو الفتات؟؟؟

وآش هو الفتات .. يااااااااااا أهل الدآر ؟؟؟

شخشوخة الظفر .. لم أسمع بها من قبل
و حسب الصور التي أدرجتها ليست هي

صراحة فضولي يزداد لمعرفة أكلة الأح نائل

لالا .. بل هي ..
اكتبيها في قوقل .. [ شخشوخة الظفر ] .. تأتيك ..

وعليكم السلام
شكرا على المتابعة والاهتمام
نعم هو الفتات بعينه
ولكن رغبة في التواصل في الدار أردت ان أعرف ما يسميه البعض
وكيفية تحضيره
شكرا راوية وأميمة ومعا الى الله على الرغبة الى المعرفة وشكرا للجميع
بارك الله في الجميع

مممم .. هذي أكلة جديدة .. :rolleyes:

قوليلي من ماذا يتكوّن .. ربّما نحن لا نسمّيه كذلك ..
و ربّما تعرّفتُ عليه .. :rolleyes:

المشاركة الأصلية كتبت بواسطة رابحي نائل http://www.djelfa.info/vb/images/buttons/viewpost.gif (http://www.djelfa.info/vb/showthread.php?p=8784876#post8784876)

اليكم هذه الاكلة والهدية التقليدية التقتطها قبل أيام على ضفاف البادية

فحاولن التعرف عليها
الصورة تظهر وسطها بقعة صفراء هي الدهان الحر

http://www.djelfa.info/vb/images/statusicon/wol_error.gifإضغط هنا لرؤية الصورة بحجمها الطبيعي.http://www8.0zz0.com/2012/02/06/19/490638259.jpg

http://www.djelfa.info/vb/images/statusicon/wol_error.gifإضغط هنا لرؤية الصورة بحجمها الطبيعي.http://www8.0zz0.com/2012/02/06/19/984079477.jpg

http://www.djelfa.info/vb/images/statusicon/wol_error.gifإضغط هنا لرؤية الصورة بحجمها الطبيعي.http://www12.0zz0.com/2012/02/06/15/483338067.jpg

السلام عليكم
الله الله مكانش فيكم اللي يعرف يعرض؟؟؟؟ تاكلوا وحدكم ؟؟؟
أظن انها المقطيعة كما أشارت الأخت رواية

و عليكم السلام و رحمة الله و بركاته ..

مرحبآ بأخونآ مصطفى ..
و هل نعرض أصحاب الدار ؟ :rolleyes:

كيف لا و انت من اصحاب الدار ..
اليست الدار داركم ؟؟ :rolleyes:

اذن مرحبا بيك في كلّ وقت .. بلا عرضة ..
جيب حقّك بيدّك .. سينو ما يصيحلك والو معانا :1:

أنتظر أن يخبرني أحدكم .. مما تتكون المقيطعة و الفتات .. ؟؟؟

قد أعرفهما بتسمية أخرى ..



آلاء الرحـــــــمن
2012-02-06, 21:45
اهلا بكم غبت قليلا وجدتكم ضيعتم المقطيعة بين فتات وشخشوخة ظفر وهي كلها اسماء لطبق واحد المختلف فقط اللهجة
والله الواحد حصل اذا ما كنتش حاضرة تلفوها للواحد ....
والله الموضوع يزداد بين لحظة واخرى روعة واناقة و جمالا وفوائد...
هي فكرة رائعة ان يقدم لنا كل واحد معلومات عن ولايته وعن عاداتها وتقاليدها...
هكذا نزداد فائدة حتى عندما يذهب احدنا الى ولاية اخرى يعرف واش يدير وكي يجيبولوا كاش حاجة يعرفها واش هيا ...
في انتظار البقية لكي يحدثونا عن ولاياتهم ولكن بالتفصيل الذي قدمناه عن ولايتنا الجلفة ....
اكثر مشاركة اعجبتني هي مشاركة الاخ سعيد على الاقل انت اكلت طبقا منها نحن نقلناها و لكننا نظرنا اليها فقط وتلوت مصرينا بلا فايدة

معاً إلى الله
2012-02-06, 21:47
امممممممممممممممم انا التزمت الصمت لاني حرت فيها
حتى الوالدة حارت فيها
طلعت اخر شي فتات
يلا مش مشكل بصحتكم

وآش هو الفتآآآآآآت .. http://www.djelfa.info/vb/images/icons/456ty.gif

خويا رابحي والله ماحقت تسخفنا


مرحبآ بيك في دارنا .. :mh31:

السلام عليكم

و أخيرا ... عموما من خلال الصور هو مختلف تماما عن الفتات الذي نعده نحن
هناك عدة طرق لأعداده .. التقليدي
و الآخر الذي يسقى بالعسل و المكسرات
بارك الله فيك أخ نائل
هنيئا لكم

و أخيرا احدهم يعرف المقطيعة :1:

وآش هو الفتآآآآآآت .. http://www.djelfa.info/vb/images/icons/456ty.gif

عطر الملكة
2012-02-06, 21:52
اهلا بكم غبت قليلا وجدتكم ضيعتم المقطيعة بين فتات وشخشوخة ظفر وهي كلها اسماء لطبق واحد المختلف فقط اللهجة
والله الواحد حصل اذا ما كنتش حاضرة تلفوها للواحد ....
والله الموضوع يزداد بين لحظة واخرى روعة واناقة و جمالا وفوائد...
هي فكرة رائعة ان يقدم لنا كل واحد معلومات عن ولايته وعن عاداتها وتقاليدها...
هكذا نزداد فائدة حتى عندما يذهب احدنا الى ولاية اخرى يعرف واش يدير وكي يجيبولوا كاش حاجة يعرفها واش هيا ...
في انتظار البقية لكي يحدثونا عن ولاياتهم ولكن بالتفصيل الذي قدمناه عن ولايتنا الجلفة ....
اكثر مشاركة اعجبتني هي مشاركة الاخ سعيد على الاقل انت اكلت طبقا منها نحن نقلناها و لكننا نظرنا اليها فقط وتلوت مصرينا بلا فايدة

لا يا اختي بيرلا انا راني اكلتها اليوم في الغداء
كان بقالي شوية رقاق مفتت طيبتلوا مرق و تغدينا بيه
طبق عالكيف
اما الاخ سعيد مزية انو الوالدة اتلات فيه و ما خلاتهاش في قلبو
ربي يحفظلك الوالدة
و الاخ نائل دوخني بالطبق و الله راسي حبس
اخر شي طلع فتات
بيرلا تخطينا نضيعوا
الله يحفظك لينا
ابقاي دائما بالجوار
من الصبح انا و البنات دايرين نقاش و لا في هيئة الامم المتحدة على حكاية الطبق

معاً إلى الله
2012-02-06, 21:55
اهلا بكم غبت قليلا وجدتكم ضيعتم المقطيعة بين فتات وشخشوخة ظفر وهي كلها اسماء لطبق واحد المختلف فقط اللهجة
والله الواحد حصل اذا ما كنتش حاضرة تلفوها للواحد ....
والله الموضوع يزداد بين لحظة واخرى روعة واناقة و جمالا وفوائد...
هي فكرة رائعة ان يقدم لنا كل واحد معلومات عن ولايته وعن عاداتها وتقاليدها...
هكذا نزداد فائدة حتى عندما يذهب احدنا الى ولاية اخرى يعرف واش يدير وكي يجيبولوا كاش حاجة يعرفها واش هيا ...
في انتظار البقية لكي يحدثونا عن ولاياتهم ولكن بالتفصيل الذي قدمناه عن ولايتنا الجلفة ....
اكثر مشاركة اعجبتني هي مشاركة الاخ سعيد على الاقل انت اكلت طبقا منها نحن نقلناها و لكننا نظرنا اليها فقط وتلوت مصرينا بلا فايدة

شفتي كيفآش .. :rolleyes:
شخشخونا و قطعونا و فتونا .. و ما حبوش يقولولي لاغوسات :1:
و الله كنت حاسة رانا ندوروا في طبق واحد ..

تقولي رانا هنا من مختلف الدول .. :1:
و نحن بالكاد تفصلنا بعض الولايات ..

بصّح انا الحاجة لي ما فهمتهاش .. علاش كاين بزاف لهجآت في بلادي ..

كنت عارفة بلي اللهجات تختلف ..
لكن ماشي لهاذ الدرجة .. :1:

لوكان ماشي التصاور .. واحد ما يفهم لاخر .. :1::1:


و الله سعيدة أنا بتعرّفي اليوم أكثر على الجلفة و عوايدها ..
و راني حاسة رايحة نّومها في الحلم اليوم .. ;)

أمّآ عن نفسي فغدا ان شاء الله ..
سأسلّط سلاطة حااااارة .. :1: .. و راكم معروضين جميعا ..

و لستُ مسؤولة عن أيّ مصارين أخرى تتلوى هنآ .. :1::1:

heureusement ما راناش في رمضان .. :)

سلامي للجميع


عطر الملكة
2012-02-06, 21:55
اختي راوية انا نعرف هذاك الفتات نتاع العسل و المكسرات ندوه للعروس في الصبحية

2012-02-06, 21:59
اليكم هذه الاكلة والهدية التقليدية التقتطها قبل أيام على ضفاف البادية
فحاولن التعرف عليها
الصورة تظهر وسطها بقعة صفراء هي الدهان الحر




نعم حنا كذلك نسموها المقطيعة
وما أجملها حين تكون بزيت الزيتون :rolleyes:

شكرا لك يا رابحي أحسنت الإختيار :19:

معاً إلى الله
2012-02-06, 22:00
لا يا اختي بيرلا انا راني اكلتها اليوم في الغداء
كان بقالي شوية رقاق مفتت طيبتلوا مرق و تغدينا بيه
طبق عالكيف
اما الاخ سعيد مزية انو الوالدة اتلات فيه و ما خلاتهاش في قلبو
ربي يحفظلك الوالدة
و الاخ نائل دوخني بالطبق و الله راسي حبس
اخر شي طلع فتات
بيرلا تخطينا نضيعوا
الله يحفظك لينا
ابقاي دائما بالجوار
من الصبح انا و البنات دايرين نقاش و لا في هيئة الامم المتحدة على حكاية الطبق

بصحّـــتكم .. :19:

2012-02-06, 22:02
انا نجبــــــد روحي ضرك مانعرف ندير والو ..............
المهم كاش مايحلف واحد راني هنا في الخدمة الايميل ورقم الهاتف والعنوان كامل حاطهم بجيهة

آلاء الرحـــــــمن
2012-02-06, 22:03
اختي معا الى الله تحياتي ...
رانا من الصباح نجبدو ونرولكم في عادتنا وتقاليدنا ...
وانتي عاصمية وما قلتيلنا والو على العاصمة البيضاء ...
مع اننا نعرف التقاليد مثلا اللباس نتاعكم ولكن عرفينا اكثر عليها ...
فهي عاصمة الجزائر وليست شيء سهلا ....

معاً إلى الله
2012-02-06, 22:03
اختي راوية انا نعرف هذاك الفتات نتاع العسل و المكسرات ندوه للعروس في الصبحية

نعم حنا كذلك نسموها المقطيعة
وما أجملها حين تكون بزيت الزيتون :rolleyes:

شكرا لك يا رابحي أحسنت الإختيار :19:

مادابيكم .. لي يهدر على كاش أكلة يخلّص ضريبة ..
تتمثّل في الشّرح المفصّل لهآ .. :1:

محمد حانطي
2012-02-06, 22:03
السلام عليكم

قالك على كرشو يخلي عرشو


مصطفى وتحلى الحياة ههههه

الى كل الاخوات هنا

كل وحدة تقول الصح واش تعرف تطيب من الاطباق التقلدية الي مرو على الموضوع

كامل لبنات جاوبو ولازم تكون الصراحة ماتتحشموش هههههه

اليكم الخط

معاً إلى الله
2012-02-06, 22:07
انا نجبــــــد روحي ضرك مانعرف ندير والو ..............
المهم كاش مايحلف واحد راني هنا في الخدمة الايميل ورقم الهاتف والعنوان كامل حاطهم بجيهة

هل تعرف المثل لي يقول :

** حلفنآ عليه يتعشى .. حلّ حزامو و بآت ** :1:

سيحلفون عليك أكيد .. :1:

آلاء الرحـــــــمن
2012-02-06, 22:08
انا نجبــــــد روحي ضرك مانعرف ندير والو ..............
المهم كاش مايحلف واحد راني هنا في الخدمة الايميل ورقم الهاتف والعنوان كامل حاطهم بجيهة
خويا راك تسال راهم زوج ظرك ياخي؟؟؟؟
فكرتني في حكايات الحلف والله الواحد يقتلو الضحك ذاك يحلف و لاخر تلقاه ادا الحاجة ويحلف عليها والله عجب....:rolleyes:

2012-02-06, 22:08
السلام عليكم

قالك على كرشو يخلي عرشو


مصطفى وتحلى الحياة ههههه

شكـــرا محمد

2012-02-06, 22:09
تنويـــــــه: المتوسط الحسابي للموضوع هو الدردشة الايجابية .............. الانحراف المعياري للموضوع الدردشة التي لاطائل منها

2012-02-06, 22:09
وآش هو الفتآآآآآآت .. http://www.djelfa.info/vb/images/icons/456ty.gif

الفتات أكلة تقليدية فيها نوعان
العصري :1:
تجيبي المسمن و تقطيعه قطع صغيرة


تضيفيلوا السمن و المكسرات حسب اختيارك
و تسقيه بالعسل
يجي هايل

و كاين فتات تقليدي .. انتاع زمان
استناي حتى نسقسي عليه مليح :1:

2012-02-06, 22:10
مصطفى وتحلى الحياة ههههه

شكرا محمد [/quote]

ضربة زوج وداما ....... انا ولا انت ولا في زوج هههههههههه

المصفى تحياتنا

عطر الملكة
2012-02-06, 22:10
السلام عليكم

قالك على كرشو يخلي عرشو


مصطفى وتحلى الحياة ههههه

الى كل الاخوات هنا

كل وحدة تقول الصح واش تعرف تطيب من الاطباق التقلدية الي مرو على الموضوع

كامل لبنات جاوبو ولازم تكون الصراحة ماتتحشموش هههههه

اليكم الخط

ايوة ايوة جينا لصح

اولا : الشخشوخة بكل خطواتها مع شرط ضروري اني نطيبها وحدي كي نكون نحضر فيها ما نحب حتى واحد يساعدني مام الرقاق نخدموا وحدي
ثانيا : المردود تعلمتوا تلقائيا بفضل الوالدة لانها غالبا ما نهار الخميس او الجمعة تخرجهم صدقة
ثالثا : الكسكس اعتقد كل نايلية تعرفوا حتميا الله غالب راك عارف البير بغطاه
و طبعا الكعبوش و الروينة هذوا بلا ما نهدروا

آلاء الرحـــــــمن
2012-02-06, 22:11
السلام عليكم

قالك على كرشو يخلي عرشو


مصطفى وتحلى الحياة ههههه

الى كل الاخوات هنا

كل وحدة تقول الصح واش تعرف تطيب من الاطباق التقلدية الي مرو على الموضوع

كامل لبنات جاوبو ولازم تكون الصراحة ماتتحشموش هههههه

اليكم الخط
مدام انا ذكرت الاطباق بالتفصيل اكيد راني نخدمهم مليح انا الحلويات خاطيني ما نفهم والو فيهم ...
اختي معا الى الله ساوافيك بكيفية تحضير الطبق حالما اسأل امي عن كيفية تحضيره فبصراحة عندنا شحال ما درناهاش و نسيت كيفاه تتخدم ....
اذا ما سبقتنيش كاش اخت بالطريقة ....

2012-02-06, 22:12
خويا راك تسال راهم زوج ظرك ياخي؟؟؟؟
فكرتني في حكايات الحلف والله الواحد يقتلو الضحك ذاك يحلف و لاخر تلقاه ادا الحاجة ويحلف عليها والله عجب....:rolleyes:

لاتكثري على نفسك بيرلا فا المسافة هي المشكل وانا راني صامط ههههه

وعلاه تحلفي املا مولاها يحل الحزام وبات كما قالت معا

2012-02-06, 22:14
السلام عليكم

يبدو أن البرد مداير حالة في بطون الإخوة و الأخوات ههههههه

أريد أن أريكم صورة لطبق قسنطيني و هو المفضل عندي بعد الرفيس القسنطيني و لي يجيب اسمه نستعرف بيه

http://im9.gulfup.com/2012-02-07/1328566335201.jpg (http://www.gulfup.com/show/X39qwmwtcwmub)

يؤكل مع اللبن مثل الرفيس تماما:19::19::19:

2012-02-06, 22:14
هل تعرف المثل لي يقول :

** حلفنآ عليه يتعشى .. حلّ حزامو و بآت ** :1:

سيحلفون عليك أكيد .. :1:

وقيلا انتم يا العاصميين .... تقولاها ههه
العاصمة ماتفهملها والو بحكم تجربتي المتواضعة فيها وبحكم اني كل اسبوع نروح ليها مرة او مرتين ....

اذا حلفوا مانقولوش لالا واذا ماعرضوناش رانا نتاسفوا وخلاص


آلاء الرحـــــــمن
2012-02-06, 22:21
على بالكم كنت في السابق ادخل الى المنتدى الاسلامي بكثرة و كنت منين ذاك ندخل في المواضيع العامة نحط رد ونمشي و لكن الان فاتحة صفحة الدار داركم وما رانيش نخرج الا نادرا اذا شفت كاش موضوع مليح في الصفحة لاخرى اللي فاتحتها لمنتدى الجلفة نقراه و لا نحط رد بسيط و نرجع مسرعة الى دارنا ربي يدوم الحال ....
شكرا لكي كثيرا جدا جدا جدا ............................ جدا اختي معا الى الله على هذا الموضوع الجيد...
مع العلم انني لم اسجل في اي منتدى آخر

محمد حانطي
2012-02-06, 22:22
شكرا محمد

ضربة زوج وداما ....... انا ولا انت ولا في زوج هههههههههه

المصفى تحياتنا[/quote]
ضربة زوج ناقص واحد ياو راني على حبيب الماكلة ههههههه

ايوة ايوة جينا لصح

اولا : الشخشوخة بكل خطواتها مع شرط ضروري اني نطيبها وحدي كي نكون نحضر فيها ما نحب حتى واحد يساعدني مام الرقاق نخدموا وحدي
ثانيا : المردود تعلمتوا تلقائيا بفضل الوالدة لانها غالبا ما نهار الخميس او الجمعة تخرجهم صدقة
ثالثا : الكسكس اعتقد كل نايلية تعرفوا حتميا الله غالب راك عارف البير بغطاه
و طبعا الكعبوش و الروينة هذوا بلا ما نهدروا



مدام انا ذكرت الاطباق بالتفصيل اكيد راني نخدمهم مليح انا الحلويات خاطيني ما نفهم والو فيهم ...
اختي معا الى الله ساوافيك بكيفية تحضير الطبق حالما اسأل امي عن كيفية تحضيره فبصراحة عندنا شحال ما درناهاش و نسيت كيفاه تتخدم ....
اذا ما سبقتنيش كاش اخت بالطريقة ....


مزال مالحقتوش 10/10


معاً إلى الله
2012-02-06, 22:23
اختي معا الى الله تحياتي ...
رانا من الصباح نجبدو ونرولكم في عادتنا وتقاليدنا ...
وانتي عاصمية وما قلتيلنا والو على العاصمة البيضاء ...
مع اننا نعرف التقاليد مثلا اللباس نتاعكم ولكن عرفينا اكثر عليها ...
فهي عاصمة الجزائر وليست شيء سهلا ....

أهلآ أختي بيرلا ..
و سقطتْ معآ الى الله في الفخ .. :1:

أكي حبيبتي مآ يكون إلّآ خآطرك .. :19:

أنآ .. وُلدتُ و ترعرعتُ طوال حياتي في العاصمة ..
بالضبط في بوزريعة .. و حآليآ اهلي في رويبة .. :)

لكن هذآ لم يمنعنا بالتمسّك بجذورنآ القبآئليّة الأصل .. :)
فأنا قبائليّة من القبائل الصغرى ..

لذلك فعاداتنا تتنوّع بين ما هو قبائلي و ما هو عاصمي ..
شدّينا من هنا و من هنا :1:


نحكيلكم شويّة على المأكولات القبائليّة ..
لأنّو ربّما ما تعرفوهاش .. :rolleyes:

كاين واحد الأكلة يسموهآ :

تيكربابين ... و كاين في العاصمة لي يقولولها .. العصبان .. :)


و كآين .. البركوكس نقولولو باللهجة القبائلية .. آبآزين .. :)


و أكيد الطعام أو الكسكسي أو كما يدعى باللهجة القبائلية : سكسو :)

http://t2.gstatic.com/images?q=tbn:ANd9GcRy8tcjM8a8Q6fQcSgSomJYjHxsacaop 2Pwj1koDiYZOPHr62_tjgLO-Z9PNA

و في العاصمة نديروا في المناسبات التقليدية .. الرشتة .. :)


بالاضافة الى بعض الأكلات الأخرى الغنية عن التعريف ..

مثل: المثوّم و شطيطحة جاج .. و اللحم لحلو ..
طآجين الخوخ ..

و الكثير و الكثير ..

حين اتذكّر سأعود أكيد .. :)

و أنا هنا لأيّ وصفة و لأيّ ترجمة تريدونهآ .. :19:

عطر الملكة
2012-02-06, 22:30
أهلآ أختي بيرلا ..
و سقطتْ معآ الى الله في الفخ .. :1:

أكي حبيبتي مآ يكون إلّآ خآطرك .. :19:

أنآ .. وُلدتُ و ترعرعتُ طوال حياتي في العاصمة ..
بالضبط في بوزريعة .. و حآليآ اهلي في رويبة .. :)

اممممممممممممممممممم نعرف منطقة بوزريعة مليح
اغ دو فرونس حتى نهبطوا لشوفالي و طريق الجامعة من هيه حتى نورحو لبني مسوس

لكن هذآ لم يمنعنا بالتمسّك بجذورنآ القبآئليّة الأصل .. :)
فأنا قبائليّة من القبائل الصغرى ..

لذلك فعاداتنا تتنوّع بين ما هو قبائلي و ما هو عاصمي ..
شدّينا من هنا و من هنا :1:


نحكيلكم شويّة على المأكولات القبائليّة ..
لأنّو ربّما ما تعرفوهاش .. :rolleyes:

كاين واحد الأكلة يسموهآ :

تيكربابين ... و كاين في العاصمة لي يقولولها .. العصبان .. :)


و كآين .. البركوكس نقولولو باللهجة القبائلية .. آبآزين .. :)


و أكيد الطعام أو الكسكسي أو كما يدعى باللهجة القبائلية : سكسو :)

http://t2.gstatic.com/images?q=tbn:and9gcry8tcjm8a8q6fqcsgsomjyjhxsacaop 2pwj1kodiyzophr62_tjglo-z9pna

و في العاصمة نديروا في المناسبات التقليدية .. الرشتة .. :)


بالاضافة الى بعض الأكلات الأخرى الغنية عن التعريف ..

مثل: المثوّم و شطيطحة جاج .. و اللحم لحلو ..
طآجين الخوخ ..

و الكثير و الكثير ..

حين اتذكّر سأعود أكيد .. :)

و أنا هنا لأيّ وصفة و لأيّ ترجمة تريدونهآ .. :19:

انا حضرت بعض اعراس ناس العاصمة
مختلفة عن اولاد نائل

اولا العرس يكون بقاعة اعراس نادرا ما نشوف ناس عاملين عرس ببيتهم
ثانيا : العرس يكون امسية تتصدر فيها لعروس مع تنوع كبير في الحلويات بصراحة قطعة الحلوة تحفة فنية ما يطوعنيش قلبي ناكلها تحفة و الله مع المشروبات طبعا
ثالثا : لما تنتهي الامسية تتفرق الناس و يبقاوا تقريبا غير اهل العروسة و اهل العريس و المقربين جدا للعشاء
انا العرس الي حضرتوا كان العشاء كسكس بالمرق الابيض و الديسار و القازوز

معاً إلى الله
2012-02-06, 22:40
السلام عليكم

قالك على كرشو يخلي عرشو


مصطفى وتحلى الحياة ههههه

الى كل الاخوات هنا

كل وحدة تقول الصح واش تعرف تطيب من الاطباق التقلدية الي مرو على الموضوع

كامل لبنات جاوبو ولازم تكون الصراحة ماتتحشموش هههههه

اليكم الخط

الطعام + الرشتة + شخشوخة ..... الخ .. :1:

لكن أختك شاطرة في الحلويات أكثر .. :rolleyes:

تنويـــــــه: المتوسط الحسابي للموضوع هو الدردشة الايجابية .............. الانحراف المعياري للموضوع الدردشة التي لاطائل منها

لم أفهم .. خير ان شاء الله .... :confused:

الفتات أكلة تقليدية فيها نوعان
العصري :1:
تجيبي المسمن و تقطيعه قطع صغيرة


تضيفيلوا السمن و المكسرات حسب اختيارك
و تسقيه بالعسل
يجي هايل

و كاين فتات تقليدي .. انتاع زمان
استناي حتى نسقسي عليه مليح :1:

الحمد لله لي سمعني واحد فيكم
بارك الله فيك أختي راوية .. :19:

ايوة ايوة جينا لصح

اولا : الشخشوخة بكل خطواتها مع شرط ضروري اني نطيبها وحدي كي نكون نحضر فيها ما نحب حتى واحد يساعدني مام الرقاق نخدموا وحدي
ثانيا : المردود تعلمتوا تلقائيا بفضل الوالدة لانها غالبا ما نهار الخميس او الجمعة تخرجهم صدقة
ثالثا : الكسكس اعتقد كل نايلية تعرفوا حتميا الله غالب راك عارف البير بغطاه
و طبعا الكعبوش و الروينة هذوا بلا ما نهدروا

ما شاء الله عليك أختي .... :19:

مدام انا ذكرت الاطباق بالتفصيل اكيد راني نخدمهم مليح انا الحلويات خاطيني ما نفهم والو فيهم ...
اختي معا الى الله ساوافيك بكيفية تحضير الطبق حالما اسأل امي عن كيفية تحضيره فبصراحة عندنا شحال ما درناهاش و نسيت كيفاه تتخدم ....
اذا ما سبقتنيش كاش اخت بالطريقة ....

شكرا لكِ بيرلا .. ساليلي عليهآ بزآف ..
و اذا كاش ما خصّك كاش وصفة في الحلويات .. راني هنا .. :19:

لاتكثري على نفسك بيرلا فا المسافة هي المشكل وانا راني صامط ههههه

وعلاه تحلفي املا مولاها يحل الحزام وبات كما قالت معا

مش أنا لي قلت .. هوما لي قالو .. :1:

السلام عليكم

يبدو أن البرد مداير حالة في بطون الإخوة و الأخوات ههههههه

أريد أن أريكم صورة لطبق قسنطيني و هو المفضل عندي بعد الرفيس القسنطيني و لي يجيب اسمه نستعرف بيه

http://im9.gulfup.com/2012-02-07/1328566335201.jpg (http://www.gulfup.com/show/X39qwmwtcwmub)

يؤكل مع اللبن مثل الرفيس تماما:19::19::19:

مرحبى بالضيف و ما حمل ..
أهلا بكم الدار داركم ...

ممممم هذآ منعرفووووش .. :rolleyes:

ترى ما هو ؟؟؟

وقيلا انتم يا العاصميين .... تقولاها ههه
العاصمة ماتفهملها والو بحكم تجربتي المتواضعة فيها وبحكم اني كل اسبوع نروح ليها مرة او مرتين ....

اذا حلفوا مانقولوش لالا واذا ماعرضوناش رانا نتاسفوا وخلاص


هو مثل أعتقد أنو معروف وطنيآآآ ..
أنا من لي كنت صغيرة نعرفو .. :1:

و مآذآ يا ترى لم يفهم أخي الكريم في العاصمة .. أتقصد اللهجة ؟؟

رآنآ هنا خو ... :1:

على بالكم كنت في السابق ادخل الى المنتدى الاسلامي بكثرة و كنت منين ذاك ندخل في المواضيع العامة نحط رد ونمشي و لكن الان فاتحة صفحة الدار داركم وما رانيش نخرج الا نادرا اذا شفت كاش موضوع مليح في الصفحة لاخرى اللي فاتحتها لمنتدى الجلفة نقراه و لا نحط رد بسيط و نرجع مسرعة الى دارنا ربي يدوم الحال ....
شكرا لكي كثيرا جدا جدا جدا ............................ جدا اختي معا الى الله على هذا الموضوع الجيد...
مع العلم انني لم اسجل في اي منتدى آخر

مرحبا بيك حبيبتي ..
ان شاء الله ما نكونش سبب في ابعادك عن القسم الاسلامي .. :sdf:

و الله مام أنا .. هذا الموضوع راه دالي وقتي مناصفةً مع اوقاتي الأخرى ..
وليت ما نحبطش للردشوسي ..
ديمآ في السطح .. :1:

ربّي يخلينا لبعضآنآ .. و يقرّبنا أكثر و أكثر ..
و يجعل هذا الموضوع سبب لهدايتنا و هداية الكثيرين ..


2012-02-06, 22:49
لا تقلق طالما سلمت زمام الامور لمحامي خلاص اتركها على الله و محاميك
الله ييسر امورك

شكرا يا أختي إدعي لي في السجود إن شاء الله نربح هذه القضية إن شاء الله
قلة لأمي هناك ناس ساعدوني في الأنترنات فدعة لكم بي الخير

أنا عندي 26 سنة في عمري نوية ندير دار و الحلال و صقطة في عائلة نصابين إن شاء الله يضهر الحق و أكسب القضية
إن شاء الله يأجرني في هذه المصيبة و يعوضني بلخير إن شاء الله

2012-02-06, 22:52
مرحبى بالضيف و ما حمل ..
أهلا بكم الدار داركم ...

ممممم هذآ منعرفووووش .. :rolleyes:

ترى ما هو ؟؟؟


شكرا على الاستضافة أختي معا إلى الله

نعطوا فرصة للآخرين ربما يعرفوا هاذ الطبق
لكن صراحة أعتقد أنه يعرفوه فقط القسنطينيين و منهم من لا يعرفه فهو يقدم في مناسبات خاصة مثل الخطبة

عطر الملكة
2012-02-06, 22:53
شكرا يا أختي إدعي لي في السجود إن شاء الله نربح هذه القضية إن شاء الله
قلة لأمي هناك ناس ساعدوني في الأنترنات فدعة لكم بي الخير

أنا عندي 26 سنة في عمري نوية ندير دار و الحلال و صقطة في عائلة نصابين إن شاء الله يضهر الحق و أكسب القضية
إن شاء الله يأجرني في هذه المصيبة و يعوضني بلخير إن شاء الله

اخي عبد الله
راك عارف انما الاعمال بالنيات و ربي ما هوش شايفلك فيها
قدر الله و ما شاء فعل
و زيد راه كاين وحد الاحتمال خممت فيه
ربما البنت فكرت او احد من اهلها خلها تفكر و تعتقد انك سترتبط بها ربما لغرض تسهيلات معينة في الاقامة بفرنسا
هل كان لك رغبة من قبل في الهجرة الى فرنسا ؟؟؟
فلا ربما فكرت من هذ المنطلق
و زيد 26 سنة مزالك صغير ربي يفتح عليك و يعوضك خير
لكن عموما ادعلوا لك ان يفرج همك و هم كامل المغبونين

آلاء الرحـــــــمن
2012-02-06, 22:54
الطعام + الرشتة + شخشوخة ..... الخ .. :1:

لكن أختك شاطرة في الحلويات أكثر .. :rolleyes:

الله يبارك .....يا اختي نفسي صيق و الحلويات تحتاج اصحاب الاعصاب الباردة تحتاج الفناين ة انا الله غالب نتقلق ثم ثم امالا ما نحبش نخدم الحلويات

لم أفهم .. خير ان شاء الله .... :confused:
اظن انه تنبيه فقط لكي لا ينجرف الموضوع

شكرا لكِ بيرلا .. ساليلي عليهآ بزآف ..
و اذا كاش ما خصّك كاش وصفة في الحلويات .. راني هنا .. :19:

شكرا لكي عزيزتي

ممممم هذآ منعرفووووش .. :rolleyes:

ترى ما هو ؟؟؟ مام انا ما عرفتوش بصح شكلو هايل

هو مثل أعتقد أنو معروف وطنيآآآ ..
احنا نقولوا العرض سنة والبهلول يدنى
أنا من لي كنت صغيرة نعرفو .. :1:

مرحبا بيك حبيبتي ..
ان شاء الله ما نكونش سبب في ابعادك عن القسم الاسلامي .. :sdf:

و الله مام أنا .. هذا الموضوع راه دالي وقتي مناصفةً مع اوقاتي الأخرى ..
وليت ما نحبطش للردشوسي ..
ديمآ في السطح .. :1:

ربّي يخلينا لبعضآنآ .. و يقرّبنا أكثر و أكثر ..
و يجعل هذا الموضوع سبب لهدايتنا و هداية الكثيرين ..


ا ما بخصوص القسم الاسلامي اكيد انكي لست السبب بعض المواضيع تحسيها مستفزة و البعض منها مكرر ...
وكاين مواضيع ملاح ويعجبوني لكن طريقة النقاش فيهم تخليك تبتعدي خير ما تقراي حاجة ما تعجبكش نفضل نبحث في امور الدين في المواقع الاخرى و اذا لقيت موضوع مليح في منتدانا الغالي ندخل ونشارك ونشكر صاحبوا ...
اللهم آمين
ربي يوفق كل الامة الجزائرية والاسلامية ....

سآجدْ للهْ
2012-02-06, 22:56
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

السلام عليكم ورحمة الله

جمااعة هذا وين جيــت

ادعولنا يصب الثلج باه ما نقراوش غدااا

امين يا رب اميــــــــــن

وبارك الله فيكم واسعد الله مساءكم تصبحووووون على خييير

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

عطر الملكة
2012-02-06, 23:00
تصبحون على خير جميعااااااااااااااااااا

معاً إلى الله
2012-02-06, 23:00
اممممممممممممممممممم نعرف منطقة بوزريعة مليح
اغ دو فرونس حتى نهبطوا لشوفالي و طريق الجامعة من هيه حتى نورحو لبني مسوس

انا حضرت بعض اعراس ناس العاصمة
مختلفة عن اولاد نائل

اولا العرس يكون بقاعة اعراس نادرا ما نشوف ناس عاملين عرس ببيتهم
ثانيا : العرس يكون امسية تتصدر فيها لعروس مع تنوع كبير في الحلويات بصراحة قطعة الحلوة تحفة فنية ما يطوعنيش قلبي ناكلها تحفة و الله مع المشروبات طبعا
ثالثا : لما تنتهي الامسية تتفرق الناس و يبقاوا تقريبا غير اهل العروسة و اهل العريس و المقربين جدا للعشاء
انا العرس الي حضرتوا كان العشاء كسكس بالمرق الابيض و الديسار و القازوز

هي بالذات و الصفات .. air de france :1:
حومتي .. http://www.djelfa.info/vb/images/icons/icon10.gif
لا تقولي كنتِ تمرّين من هنآك ؟ واش من عوام ؟
ربّما تلاقينا .. من يدري ... :rolleyes:


أمّآ فيمآ يخصّ الأعرآس عندنآ ..
صحيح .. كلّ أعراسنا في les salle des fetes
ولّآت عادة .. تلقاي مام لي عندو ليـــستع
لكن يفضّلهآ .. لما فيها من خدمات و راحة ..

و العرس يبدى حوالي الوحدة زوالا ..
بحيث يبدى الديسك جوكي .. [ الله يهدينا ] ..
و يبدأ الضيوف في التوافد ..

في انتظآر قدوم العروسة .. التي تأتي من عند الحفافة ..

و تدخل بالطايور أبيض ..
تجلس مباشرة على كرسي التصديرة ..
و بعد لحظىت تأتي لي تصدّرها تشدها و تدوّرها على الغاشي ..
و ترجعها لغرفة التبديل ..

و هكذا يستمرّ عرض الأزياء .. حسب الألبسة التي اختارت العروس أن تظهر بهآ ..

كاين لي يوصل أكثر من 10 تبديلات ..
و ماشي شرط تخلعي و تقولي منين جاوها ..

فيوجد من تكريهآ أو تقرضهآ من عند الأقارب .. :1:

المهم ..
في تلك الأحيان لي تتصدر العروسة ..
يساربيو القازوز أولا مع ما يرافقه من حلوى [ كيش أو رولي ] ..

و كاين لي يديرو المثلجات .. [زعمة اقتصاد] .. :rolleyes:

و بعدها بمدّة يساربيو القهوة مع علب القاطو ..
و القاطو حكاية أخرى .. :1:

و في الأخير يساربيو الشاي مع الحلوى المعسلة المصاحبة له ..

في هاذاك الوقت تكون الساعة تشير الى حوالي بين الخامسة الى السادسة
يبدى الغاشي يروح ..

و آخر تصديرة للعروسة هي
la robe blanche
تلبسها .. و الديسك جوكي يدير أغنية تبكي و تقطّع القلب .. :1:

و الله الدموع يطيحو بلا ما تحبي ..

مطلعهـــآآآآ >>>

**اليوم يوم لهنا .. يا ناس هنونا .. بعد ما تهنونا روحوا و خليونا…
بنتي يا بنتي يا مفتاح البيت خدمتي على لميمة(الام) و ما قولتيش عييت(تعبت) ……الخ الخ**

و كاين لي يدير الزرنة ..

و تبدى العروس و أهلها يتباكاو ... :cool:

و يعطوها سلّة الدراجي .. مشبحين بالورود و مختلف الأشكال ..
و توزعها هي بنفسها على المعازيم ..

و من بعد يبقاو شويّة و يروحو يتعشاو ..

عادة طعام مرقة حمراء .. + دلاع أو عنب + قازوز
و خطرات .. شربة + طبق جانبي .. + ديسار ..


أما ذهاب العروسة لبيت العريس ..
فغالبا ليس في الغد .. بل بعد أسبوع .. و أحيانا أكثر .. :rolleyes:

هذا باختصار .. و ان شاء الله مزال نزيد نحكيلكم على بزّآآآف أمور .. :19:

آلاء الرحـــــــمن
2012-02-06, 23:07
أهلآ أختي بيرلا ..
و سقطتْ معآ الى الله في الفخ .. :1:

أكي حبيبتي مآ يكون إلّآ خآطرك .. :19:

أنآ .. وُلدتُ و ترعرعتُ طوال حياتي في العاصمة ..
بالضبط في بوزريعة .. و حآليآ اهلي في رويبة .. :)

لكن هذآ لم يمنعنا بالتمسّك بجذورنآ القبآئليّة الأصل .. :)
فأنا قبائليّة من القبائل الصغرى ..

لذلك فعاداتنا تتنوّع بين ما هو قبائلي و ما هو عاصمي ..
شدّينا من هنا و من هنا :1:


نحكيلكم شويّة على المأكولات القبائليّة ..
لأنّو ربّما ما تعرفوهاش .. :rolleyes:

كاين واحد الأكلة يسموهآ :

تيكربابين ... و كاين في العاصمة لي يقولولها .. العصبان .. :)


و كآين .. البركوكس نقولولو باللهجة القبائلية .. آبآزين .. :)


و أكيد الطعام أو الكسكسي أو كما يدعى باللهجة القبائلية : سكسو :)

http://t2.gstatic.com/images?q=tbn:and9gcry8tcjm8a8q6fqcsgsomjyjhxsacaop 2pwj1kodiyzophr62_tjglo-z9pna

و في العاصمة نديروا في المناسبات التقليدية .. الرشتة .. :)


بالاضافة الى بعض الأكلات الأخرى الغنية عن التعريف ..

مثل: المثوّم و شطيطحة جاج .. و اللحم لحلو ..
طآجين الخوخ ..

و الكثير و الكثير ..

حين اتذكّر سأعود أكيد .. :)

و أنا هنا لأيّ وصفة و لأيّ ترجمة تريدونهآ .. :19:

اذا انتي قبائلية الله يبارك خيار الناس....
كان عندي صديقاتي قبايليات في الجامعة من تيزي وبجاية والبويرة و كان عندي كناش نكتب فيه المصطلحات القبائلية و ترجمتها و الله كانوا بنات روعة ذكرتيني بهم ربي يخيليك
المهم من كل المصطلحات حكمت كلمة فافوناس وثايزيط على بالك التخصص يلعب دور الله غالب...:d
يبدو انكي ستظطرين الى وضع مشاركة بالمصطلحات القبائلية وآخر للامثال الشعبية ....

معاً إلى الله
2012-02-06, 23:09

القعدة معآكم حلوّة ..
و تنسي الوآحد في الوقت ..

أستسمحكم فوقتي انتهى ..
سنعود غدآ ان شاء الله ..
و أكمل الردّ عليكم بحول الله ..

بآرك الله في الجميع ..
كنتم رآئعــون .. :19:

في أمان الله .. :)



2012-02-06, 23:10
اخي عبد الله
راك عارف الاعمال بالنيات و ربي ما هوش شايفلك فيها
قدر الله و ما شاء فعل
و زيد راه كاين وحد الاحتمال خممت فيه
ربما البنت فكرت او احد من اهلها خلها تفكر و تعتقد انك سترتبط بها ربما لغرض تسهيلات معينة في الاقامة بفرنسا
هل كان لك رغبة من قبل في الهجرة الى فرنسا ؟؟؟
فلا ربما فكرت من هذ المنطلق
و زيد 26 سنة مزالك صغير ربي يفتح عليك و يعوضك خير
لكن عموما ادعلوا لك ان يفرج همك و هم كامل المغبونين

لا أبدن لم نتكلم علي فرنسا هي قد جائة للجزائر للعمل لأن في فرنسا عائلتها في أزمة كبيرة و لهم ديون

أنا عندي عمل هنا و أنا وحيد عند عائلتي قد قلت لعائلتها مرارا لا أتي إلي فرنسا لأن هم من كانو يقولو لي تعال إلي فرنسا و أنا قلة لا
أنا عندي الكتير من أفراد عائلتي في فرنسا لو أردة الذهاب هناك لتزوجة بأحد بناتهم كلهم يبحتون عن زواج

أنا الحمد لله أعيش جيدا في الجزائر ما يخصني والو الحمد لله

البنت ضربة و هددة و قد قلبو عقلها أم البنت شيطانة و نمامة كبيرة هي من خلقة المشكل و قد قلبة كل واحد ضد الأخر
سياسة فرق تسد
حسبي الله و نعم الوكيل على من ضلمني و على كل من أراد بي السوء

آلاء الرحـــــــمن
2012-02-06, 23:18
الى الغد ان شاء الله تصبحون بألف خير احبائي
احبكم في الله الى اللقاء

محمد جديدي التبسي
2012-02-07, 08:18
السلام عليكم ورحمة الله وبركاته، صباحكم خير وبركة وكل شيء جميل

بارك الله فيك اختي معا إلى الله على الكلمات الرائعة جزاك الله خيرا ووفقك

وَاِختَر قَرييك وَاِصطَفيهِ تَفاخُراً إِن القَرين إِلى المقارِن يُنسَبُ

وَإِن الغَني مِنَ الرِجالِ مُكرَم وَتَراهُ يَرجى ما لَدَيهِ وَيَرهب

وَالفَقرُ شين لِلرِّجالِ فَإِنَّهُ حَقّاً يَهونُ بِهِ الشَريف الأَنسَب

وَاِخفِض جناحِك لِلأَقارِب كُلُّهُم بِتَذلل وَاِسمَح لَهُم إِن أَذنَبوا

وَدع الكَذوب فَلا يَكن لَكَ صاحِباً إِن الكَذوب يَشين حراً يَصحب

وَزن الكَلامِ اِذا نَطَقت وَلا تَكُن ثَرثارَة في كُل نادٍ يُخطَب

وَاِحفَظ لسانك وَاِحتَرِز من لَفظِه فَالمَرءُ يَسلم بِاللِسانِ وَيعطب

وَالسر فَاِكتِمه وَلا تَنطق بِهِ إِن الزُجاجَة كَسرها لا يشعب

وَكَذاكَ سر المَرءِ إِن لَم يَطوه نَشَرَته أَلسِنَة تَزيد وَتَكذِب

لا تَحرِصَنَّ فَالحِرص لَيسَ بِزائِد في الرِزقِ بَل يَشقى الحَريص وَيَتعَب


انفاس الورد
2012-02-07, 08:51
صباحكم بنكهات ايمانية

تتخللها وصلات قرءانية

في جنباتها ادعية و صلاة على خير البرية

و لكم مني اخوتي احلى تحية

بحب الله مروية

و بمنتدى الجلفة هدية

*احبكم في الله*

انفاس الورد
2012-02-07, 09:02
التأثير في الناس وكسب محبتهم أسهل مما تتصور ..!
لا أبالغ في ذلك فقد جربته مراراً .. فوجدت أن قلوب أكثر الناس يمكن صيدها بطرق ومهارات سهلة .. بشرط أن نصدق فيها ونتدرب عليها فنتقنها ..
والناس يتأثرون بطريقة تعاملنا .. وإن لم نشعر ..
أتولى منذ ثلاث عشرة سنة الإمامة والخطابة في جامع الكلية الأمنية ..
كان طريقي إلى المسجد يمر ببوابة يقف عندها حارس أمن يتولى فتحها وإغلاقها ..
كنت أحرص إذا مررت به أن أمارس معه مهارة الابتسامة .. فأشير بيدي مسلماً مبتسماً ابتسامة واضحة .. وبعد الصلاة أركب سيارتي راجعاً للبيت ..
وفي الغالب يكون هاتفي المحمول مليئاً باتصالات ورسائل مكتوبة وردت أثناء الصلاة .. فأكون مشغولاً بقراءة الرسائل فيفتح الحارس البوابة وأغفل عن التبسم ..
حتى تفاجأت به يوماً يوقفني وأنا خارج ويقول : يا شيخ ..! أنت زعلان مني ؟!
قلت : لماذا ؟
قال : لأنك وأنت داخل تبتسم وتسلم وأنت فرحان .. أما وأنت خارج فتكون غير مبتسم ولا فرحان !!
وكان رجلاً بسيطاً .. فبدأ المسكين يقسم لي أنه يحبني ويفرح برؤيتي ..
فاعتذرت منه وبينت له سبب انشغالي ..
ثم انتبهت فعلاً إلى أن هذه المهارات مع تعودنا عليها تصبح من طبعنا .. يلاحظها الناس إذا غفلنا عنها ..

إضاءة ..

لا تكسب المال وتفقد الناس .. فإن كسب
الناس طريق لكسب المال ..


فأنت إذا أردت أن تكون رأساً لا ذيلاً .. احرص على تتبع المهارات أينما كانت .. درِّب نفسك عليها ..
كان عبد الله رجلاً متحمساً .. لكنه تنقصه بعض المهارات .. خرج يوماً من بيته إلى المسجد ليصلي الظهر .. يسوقه الحرص على الصلاة ويدفعه تعظيمه للدين ..
كان يحث خطاه خوفاً من أن تقام الصلاة قبل وصوله على المسجد ..
مر أثناء الطريق بنخلة في أعلاها رجل بلباس مهنته يشتغل بإصلاح التمر ..
عجب عبد الله من هذا الذي ما اهتم بالصلاة .. وكأنه ما سمع إذاناً ولا ينتظر إقامة ..!!
فصاح به غاضباً : انزل للصلاة ..
فقال الرجل بكل برود : طيب .. طيب ..
فقال : عجل .. صل يا حمار !!
فصرخ الرجل : أنا حمار ..!! ثم انتزع عسيباً من النخلة ونزل ليفلق به رأسه !!
غطى عبد الله وجهه بطرف غترته لئلا يعرفه .. وانطلق يعدو إلى المسجد ..
نزل الرجل من النخلة غاضباً .. ومضى إلى بيته وصلى وارتاح قليلاً .. ثم خرج إلى نخلته ليكمل عمله ..
دخل وقت العصر وخرج عبد الله إلى المسجد ..
مرّ بالنخلة فإذا الرجل فوقها ..
فقال : السلام عليكم .. كيف الحال ..
قال : الحمد لله بخير ..
قال : بشر !! كيف الثمر هذه السنة ..
قال : الحمد لله ..
قال عبد الله : الله يوفقك ويرزقك .. ويوسع عليك .. ولا يحرمك أجر عملك وكدك لأولادك ..
ابتهج الرجل لهذا الدعاء .. فأمن على الدعاء وشكر ..
فقال عبد الله : لكن يبدو أنك لشدة انشغالك لم تنتبه إلى أذان العصر !! قد أذن العصر .. والإقامة قريبة .. فلعلك تنزل لترتاح وتدرك الصلاة .. وبعد الصلاة أكمل عملك .. الله يحفظ عليك صحتك ..
فقال الرجل : إن شاء الله .. إن شاء الله ..
وبدأ ينزل برفق .. ثم أقبل على عبد الله وصافحه بحرارة .. وقال : أشكرك على هذه الأخلاق الرائعة .. أما الذي مر بي الظهر فيا ليتني أراه لأعلمه من الحمار !!


مهاراتك في التعامل مع الآخرين .. على أساسها تتحدد طريقة تعامل الناس معك ..

للشيخ محمد العريفي

معاً إلى الله
2012-02-07, 10:05
شكرا على الاستضافة أختي معا إلى الله

نعطوا فرصة للآخرين ربما يعرفوا هاذ الطبق
لكن صراحة أعتقد أنه يعرفوه فقط القسنطينيين و منهم من لا يعرفه فهو يقدم في مناسبات خاصة مثل الخطبة

مرحبآ أخي الكريم ...
ممم أرى أنو واحد مزال معرفوش .. :rolleyes:
ننتظروا تعرفنا بيه اذن .. و تحكيلنا عن عاداتكم و تقاليدكم في قسنطينة الزينة .. :)

ا ما بخصوص القسم الاسلامي اكيد انكي لست السبب بعض المواضيع تحسيها مستفزة و البعض منها مكرر ...
وكاين مواضيع ملاح ويعجبوني لكن طريقة النقاش فيهم تخليك تبتعدي خير ما تقراي حاجة ما تعجبكش نفضل نبحث في امور الدين في المواقع الاخرى و اذا لقيت موضوع مليح في منتدانا الغالي ندخل ونشارك ونشكر صاحبوا ...
اللهم آمين
ربي يوفق كل الامة الجزائرية والاسلامية ....

اللهم آمين يا رب العالمين ..
مآ أحوجنآ أن نقرأ عن ديننا أكثر ..

بارك الله فيك حبيبتي ..

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

السلام عليكم ورحمة الله

جمااعة هذا وين جيــت

ادعولنا يصب الثلج باه ما نقراوش غدااا

امين يا رب اميــــــــــن

وبارك الله فيكم واسعد الله مساءكم تصبحووووون على خييير

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

و عليكم السلام و رحمة الله و بركآته ..
أنت كي جيت حنا كنّآ رحنآ .. :1:
وآش وين كنت .. وقيل كنت مع الثلج ... :rolleyes:

موفّق في الدراسة ان شاء الله .. :mh31:

تصبحون على خير جميعااااااااااااااااااا

و أنآ أقول .. صبــــــــــح الخير يا جماعة .. :mh31:

اذا انتي قبائلية الله يبارك خيار الناس....
كان عندي صديقاتي قبايليات في الجامعة من تيزي وبجاية والبويرة و كان عندي كناش نكتب فيه المصطلحات القبائلية و ترجمتها و الله كانوا بنات روعة ذكرتيني بهم ربي يخيليك
المهم من كل المصطلحات حكمت كلمة فافوناس وثايزيط على بالك التخصص يلعب دور الله غالب...:d
يبدو انكي ستظطرين الى وضع مشاركة بالمصطلحات القبائلية وآخر للامثال الشعبية ....

مكىن حتى مشكل حبيبتي .. اطلبي و أنا أترجم على قدر استطاعتي ..
في ما يخص الكلمة الأولى .. راكي غالطة :1:
مش فافوناس >>>

ثافوناست = بقرة

و الثانية صحيحة :

ثيازيط = دجآجة ...

ممم زيدي .. واش حابّة تعرفي ؟؟؟؟ ........ :rolleyes:

الى الغد ان شاء الله تصبحون بألف خير احبائي
احبكم في الله الى اللقاء

أحبّكِ الله الذي أحببتنا فيه ..

صباحكم سعيد بذكر الله .. :mh31:

السلام عليكم ورحمة الله وبركاته، صباحكم خير وبركة وكل شيء جميل

بارك الله فيك اختي معا إلى الله على الكلمات الرائعة جزاك الله خيرا ووفقك

وَاِختَر قَرييك وَاِصطَفيهِ تَفاخُراً إِن القَرين إِلى المقارِن يُنسَبُ

وَإِن الغَني مِنَ الرِجالِ مُكرَم وَتَراهُ يَرجى ما لَدَيهِ وَيَرهب

وَالفَقرُ شين لِلرِّجالِ فَإِنَّهُ حَقّاً يَهونُ بِهِ الشَريف الأَنسَب

وَاِخفِض جناحِك لِلأَقارِب كُلُّهُم بِتَذلل وَاِسمَح لَهُم إِن أَذنَبوا

وَدع الكَذوب فَلا يَكن لَكَ صاحِباً إِن الكَذوب يَشين حراً يَصحب

وَزن الكَلامِ اِذا نَطَقت وَلا تَكُن ثَرثارَة في كُل نادٍ يُخطَب

وَاِحفَظ لسانك وَاِحتَرِز من لَفظِه فَالمَرءُ يَسلم بِاللِسانِ وَيعطب

وَالسر فَاِكتِمه وَلا تَنطق بِهِ إِن الزُجاجَة كَسرها لا يشعب

وَكَذاكَ سر المَرءِ إِن لَم يَطوه نَشَرَته أَلسِنَة تَزيد وَتَكذِب

لا تَحرِصَنَّ فَالحِرص لَيسَ بِزائِد في الرِزقِ بَل يَشقى الحَريص وَيَتعَب


و عليكم السلام و رحمة الله و بركاته ..

مرحبا أخونا الكريم [ محمد ] ..
و جزآك الله خيرآ .. رآك ديمآ سباق للدار كلّ صباح .. :rolleyes:
أسعدك الله و وفّقك و أصلح أمورك كلّهآ ..


صباحكم بنكهات ايمانية

تتخللها وصلات قرءانية

في جنباتها ادعية و صلاة على خير البرية

و لكم مني اخوتي احلى تحية

بحب الله مروية

و بمنتدى الجلفة هدية

*احبكم في الله*

و صباحكِ عطرٌ يا أنفاس الوروود ..
جميلٌ بذكر الله .. و ذنوبٌ لا تعوود ..
حسنآتٍ تتهاطل و رضى من ربٍّ ودوود ..

مرحبآآآ .. و أحبّكِ الله الذي أحببتنا فيه .. :mh31:
و انى كذلك احبّكِ في الله .. :)

التأثير في الناس وكسب محبتهم أسهل مما تتصور ..!
لا أبالغ في ذلك فقد جربته مراراً .. فوجدت أن قلوب أكثر الناس يمكن صيدها بطرق ومهارات سهلة .. بشرط أن نصدق فيها ونتدرب عليها فنتقنها ..
والناس يتأثرون بطريقة تعاملنا .. وإن لم نشعر ..
أتولى منذ ثلاث عشرة سنة الإمامة والخطابة في جامع الكلية الأمنية ..
كان طريقي إلى المسجد يمر ببوابة يقف عندها حارس أمن يتولى فتحها وإغلاقها ..
كنت أحرص إذا مررت به أن أمارس معه مهارة الابتسامة .. فأشير بيدي مسلماً مبتسماً ابتسامة واضحة .. وبعد الصلاة أركب سيارتي راجعاً للبيت ..
وفي الغالب يكون هاتفي المحمول مليئاً باتصالات ورسائل مكتوبة وردت أثناء الصلاة .. فأكون مشغولاً بقراءة الرسائل فيفتح الحارس البوابة وأغفل عن التبسم ..
حتى تفاجأت به يوماً يوقفني وأنا خارج ويقول : يا شيخ ..! أنت زعلان مني ؟!
قلت : لماذا ؟
قال : لأنك وأنت داخل تبتسم وتسلم وأنت فرحان .. أما وأنت خارج فتكون غير مبتسم ولا فرحان !!
وكان رجلاً بسيطاً .. فبدأ المسكين يقسم لي أنه يحبني ويفرح برؤيتي ..
فاعتذرت منه وبينت له سبب انشغالي ..
ثم انتبهت فعلاً إلى أن هذه المهارات مع تعودنا عليها تصبح من طبعنا .. يلاحظها الناس إذا غفلنا عنها ..

إضاءة ..

لا تكسب المال وتفقد الناس .. فإن كسب
الناس طريق لكسب المال ..


فأنت إذا أردت أن تكون رأساً لا ذيلاً .. احرص على تتبع المهارات أينما كانت .. درِّب نفسك عليها ..
كان عبد الله رجلاً متحمساً .. لكنه تنقصه بعض المهارات .. خرج يوماً من بيته إلى المسجد ليصلي الظهر .. يسوقه الحرص على الصلاة ويدفعه تعظيمه للدين ..
كان يحث خطاه خوفاً من أن تقام الصلاة قبل وصوله على المسجد ..
مر أثناء الطريق بنخلة في أعلاها رجل بلباس مهنته يشتغل بإصلاح التمر ..
عجب عبد الله من هذا الذي ما اهتم بالصلاة .. وكأنه ما سمع إذاناً ولا ينتظر إقامة ..!!
فصاح به غاضباً : انزل للصلاة ..
فقال الرجل بكل برود : طيب .. طيب ..
فقال : عجل .. صل يا حمار !!
فصرخ الرجل : أنا حمار ..!! ثم انتزع عسيباً من النخلة ونزل ليفلق به رأسه !!
غطى عبد الله وجهه بطرف غترته لئلا يعرفه .. وانطلق يعدو إلى المسجد ..
نزل الرجل من النخلة غاضباً .. ومضى إلى بيته وصلى وارتاح قليلاً .. ثم خرج إلى نخلته ليكمل عمله ..
دخل وقت العصر وخرج عبد الله إلى المسجد ..
مرّ بالنخلة فإذا الرجل فوقها ..
فقال : السلام عليكم .. كيف الحال ..
قال : الحمد لله بخير ..
قال : بشر !! كيف الثمر هذه السنة ..
قال : الحمد لله ..
قال عبد الله : الله يوفقك ويرزقك .. ويوسع عليك .. ولا يحرمك أجر عملك وكدك لأولادك ..
ابتهج الرجل لهذا الدعاء .. فأمن على الدعاء وشكر ..
فقال عبد الله : لكن يبدو أنك لشدة انشغالك لم تنتبه إلى أذان العصر !! قد أذن العصر .. والإقامة قريبة .. فلعلك تنزل لترتاح وتدرك الصلاة .. وبعد الصلاة أكمل عملك .. الله يحفظ عليك صحتك ..
فقال الرجل : إن شاء الله .. إن شاء الله ..
وبدأ ينزل برفق .. ثم أقبل على عبد الله وصافحه بحرارة .. وقال : أشكرك على هذه الأخلاق الرائعة .. أما الذي مر بي الظهر فيا ليتني أراه لأعلمه من الحمار !!


مهاراتك في التعامل مع الآخرين .. على أساسها تتحدد طريقة تعامل الناس معك ..

للشيخ محمد العريفي

اللهمّ وفّقنآ لمآ تحبّه و ترضآه ..
اللهمّ أصلح شأننا و لا تكلنا الى انفسنا طرفة عين ..

أسعدكم الله و وفّقنا و اياكم الى ما يحبّ و يرضى ..


2012-02-07, 10:06
السلام عليكم ورحمة الله وبركاته ..... صباح الخيــــــــــر

لاشيئ يدرك بدون السعي في طلبه والارادة التامة والهمة العالية هي التي تحمل صاحبها على تحصيل العلم وبذل الجهد واغتنام الاوقات لإدراكه والبعض إنما يؤتى من همته الوضيعة وعزيمته الميتة ولذلك كان النبي صلى الله عليه وسلم يتعوذ من العجز والكسل لأن العجز والكسل قاطع عن كل خير كما أن العزيمة جالبة لكل الخير قال العلامة السعدي رحمه الله فا العزم والثبات هما السبب الأكبر لنيل المطالب المتنوعة .......

معاً إلى الله
2012-02-07, 10:06
للإستماع أضغط على غلاف المادة
http://www.altwba.com/uploads/altwba.com29.jpg (http://www.altwba.com/audios/asdarat/520-yakfy.html)
http://www.altwba.com/uploads/altwba.com4.jpg (http://www.altwba.com/audios/asdarat/508-azmat.html)

http://www.altwba.com/uploads/altwba.com3.jpg (http://www.altwba.com/audios/asdarat/497-wtobo.html)
http://www.altwba.com/uploads/altwba.com15.jpg (http://www.altwba.com/audios/asdarat/488-ala3raf.html)

http://www.altwba.com/uploads/altwba.com14.jpg (http://www.altwba.com/audios/asdarat/471-hkmah.html)
http://www.altwba.com/uploads/altwba.com18.jpg (http://www.altwba.com/audios/asdarat/470-alkoran.html)

http://www.altwba.com/uploads/altwba.com16.jpg (http://www.altwba.com/audios/asdarat/456-twba02.html)
http://www.altwba.com/uploads/altwba.com13.jpg (http://www.altwba.com/audios/asdarat/443-obida.html)

http://www.altwba.com/uploads/altwba.com1.jpg (http://www.altwba.com/audios/asdarat/427-faiz.html)
http://www.altwba.com/uploads/altwba.com7.jpg (http://www.altwba.com/audios/asdarat/405-alsadah.html)

http://www.altwba.com/uploads/altwba.com11.jpg (http://www.altwba.com/audios/asdarat/401-taeb.html)
http://www.altwba.com/uploads/al7yat.jpg (http://www.altwba.com/audios/asdarat/374-alhiat1.html)

http://www.altwba.com/uploads/altwba.com21.jpg (http://www.altwba.com/audios/asdarat/366-how.html)
http://www.altwba.com/uploads/altwba.com9.jpg (http://www.altwba.com/audios/asdarat/310-alebahyat.html)

http://www.altwba.com/uploads/altwba.com30.jpg (http://www.altwba.com/audios/asdarat/308-tawbahs.html)
http://www.altwba.com/uploads/altwba.com8.jpg (http://www.altwba.com/audios/asdarat/299-yashbab.html)

http://www.altwba.com/uploads/altwba.com12.jpg (http://www.altwba.com/audios/asdarat/298-7osnalkatemah.html)
http://www.altwba.com/uploads/altwba.com10.jpg (http://www.altwba.com/audios/asdarat/291-amaan.html)

http://www.altwba.com/uploads/altwba.com26.jpg (http://www.altwba.com/audios/asdarat/271-rhmaty.html)
http://www.altwba.com/uploads/altwba.com22.jpg (http://www.altwba.com/audios/asdarat/267-moraqbah.html)

http://www.altwba.com/uploads/altwba.com27.jpg (http://www.altwba.com/audios/asdarat/258-wkfaat.html)
http://www.altwba.com/uploads/altwba.com19.jpg (http://www.altwba.com/audios/asdarat/241-gesat.html)

http://www.altwba.com/uploads/altwba.com28.jpg (http://www.altwba.com/audios/asdarat/238-yrfod.html)
http://www.altwba.com/uploads/altwba.com17.jpg (http://www.altwba.com/audios/asdarat/230-kada.html)

http://www.altwba.com/uploads/altwba.com25.jpg (http://www.altwba.com/audios/asdarat/240-warahal.html)
http://www.altwba.com/uploads/altwba.com20.jpg (http://www.altwba.com/audios/asdarat/229-kanat.html)

http://www.altwba.com/uploads/altwba.com24.jpg (http://www.altwba.com/audios/asdarat/228-nefse.html)
http://www.altwba.com/uploads/altwba.com5.jpg (http://www.altwba.com/audios/asdarat/225-alhazar.html)

http://www.altwba.com/uploads/altwba.com23.jpg (http://www.altwba.com/audios/asdarat/223-moaeza.html)
http://www.altwba.com/uploads/altwba.com.jpg (http://www.altwba.com/audios/asdarat/183-gabla.html)

http://www.altwba.com/uploads/sa7eb.jpg (http://www.altwba.com/audios/asdarat/176-laa.html)
http://www.altwba.com/uploads/www.altwba.com5.jpg (http://www.altwba.com/audios/asdarat/635-alftah.html)

ساهم في نشر محتوى لكل من تعرف من خلال بريدك الإلكتروني وفي المواقع والمنتديات والجروبات البريدية
واكسب بشارة النبي صلى الله علية وسلم .... وتذكروا ان الدال على الخير كفاعله

معاً إلى الله
2012-02-07, 10:13
السلام عليكم ورحمة الله وبركاته ..... صباح الخيــــــــــر

لاشيئ يدرك بدون السعي في طلبه والارادة التامة والهمة العالية هي التي تحمل صاحبها على تحصيل العلم وبذل الجهد واغتنام الاوقات لإدراكه والبعض إنما يؤتى من همته الوضيعة وعزيمته الميتة ولذلك كان النبي صلى الله عليه وسلم يتعوذ من العجز والكسل لأن العجز والكسل قاطع عن كل خير كما أن العزيمة جالبة لكل الخير قال العلامة السعدي رحمه الله فا العزم والثبات هما السبب الأكبر لنيل المطالب المتنوعة .......

و عليكم السلام و رحمة الله و بركآته ..

صبآحكم سعيد بذكر الله أخي الفاضل ..
نسأل الله ان يقوّي عزائمنا في الخير .. و يعلي هممنا ..
و يجزينآ خير الثواب .. و يتجاوز عنا ..

اللهم انا نعوذ بك من العجز و الكسل ..
و سوء العمل ..

بارك الله فيك و جزاك الله خيراااا أخونا الكريم على هذه التذكرة القيّمة
فمآ أحوجنا أن يُذكّر الواحد منّا الآخر ..

طآب يومك ..


معاً إلى الله
2012-02-07, 10:16
موضوع الرسالة:http://www.nawafithna.com/images/icons/icon1.gif كيف تنجو من كيد الشيطان

وصف العنوان: محمد حسين يعقوب

بسم الله الرحمن الرحيم

السلآم عليكم ورحمة الله وبركاته

محاضرة بعنوان
:: كيف تنجو من كيد الشيطان ::

محاضرة يطرح بها الشيخ
سؤالآ قائلآ كيف حال قلوبكم مع الله ؟

:: للأستماع ::

:: للحفظ ::

من هنــأ (http://islam-call.com/uploads/Audio/kifatngomnalshitan.mp3)

معاً إلى الله
2012-02-07, 10:27
هل الاتصال بالهاتف بأحد الأقارب يعتبر من صلة الرحم ؟

وهل يجب على الرجل أن يصل ابنة عمه أو ابنة عمته، خاصة إذا كان هو الأقرب لها؟

http://xa.yimg.com/kq/groups/73017548/sn/188696655/name/390636_343756132320226_224054650957042_1323560_110 8818498_n.jpg
الجواب : الواجب على المسلمين أن تكون صلاتهم حسنة مع بعضهم بعضاً ، والرحم قسمان : رحم عام ، ورحم خاص، والمسلم للمسلم رحم ، والرحم الخاص ممن اجتمعت أنت أصولك أو فروعك وإياه في رحم ، فانت تجتمع في رحم الأم مع إخوانك وأخواتك، وأبوك يجتمع مع أعمامك وعماتك في رحم واحد وخالات...ك وأخوالك يجتمعون مع أمك في رحم واحد ، أو أن الرحم: من ترثهم ويرثوك، والمطلوب من الإنسان أن يقدم الأقرب فالأقرب والصلة عرفية فما يعد في أعراف الناس قطيعة فهو قطيعة وما يعد وصلاً فهو وصل، وليس الواصل بالمكافىء كما قال النبي صلى الله عليه وسلم فليس الواصل الذي يكافىء الناس إن جاؤوه أتاهم وإن هجروه هجرهم ، وإنما الواصل الذي يصل من قطعه فيجب على الإنسان أن يصل والراجح أن الذكور والإناث من الرحم وقد صح أن النبي صلى الله عليه وسلم نهى أن يجمع بين المرأة وعمتها وبين المرأة وخالتها وعلل ذلك بقوله {إنكم إن فعلتم ذلكم قطعتم أرحامكم} فعمة الزوجة رحم لها ، وكذلك خالتها ، وابنة العم والعمة وابنة الخال والخالة ليستا من الرحم الخاص إلا في صور نادرة كأن تفقد المرأة جميع رحمها ولم يبق لها إلا ابن العم وهو القائم على أمرها وهو الذي تأتي وتشتكي المظلمة من الزوج أو الأهل إليه فحينئذ تلحق بالرحم الخاص ويجب عليه أن يتعاهدها بالشروط الشرعية من عدم المصافحة والخلوة وعدم المحادثة إلا فيما يعود بالنفع أو فيما تكون فيه حاجة والصلة العرفية أن الناس يزورون بعضهم في المناسبات الاجتماعية كالزواج والأفراح والأتراح والتهنئة في المناسبات التي لا مخافة فيها وهكذا والحديث والمرور اليسير هو من الصلة، والحديث بالهاتف نوع من الصلة ولكن لا يجوز الاقتصار عليه، ولكن وجوده خير من عدمه، فقد صح عن النبي صلى الله عليه وسلم عن الحاكم وغيره قوله {بلوا أرحامكم ولو بالسلام} فالصلة بالهاتف من البلل فهو خير من القطيعة ولكن ليس هو الصلة المطلوبة وهذا الواجب يتفاوت باختلاف أحوال الأشخاص ؛ فالغني الواجب عليه في الصلة أن يتعاهد الفقراء من رحمه ، وقد صح عن أبي داود وغيره من حديث ابن مسعود أن الصدقة على ذي الرحم صدقتان ، والواجب على الجالس غير المقدار الواجب على العالم ، والمرابط على الثغور، فلما تتزاحم الحقوق يقدم الإنسان الأولى فالأولى ، ويجب على الجميع أن يكون واصلاً لرحمه على قدر استطاعته ولقد وجدت أن أصعب فرض في دين الله أن تعطي كل ذي حق حقه ، أن تعطي الزوجة حقها ، والرحم حقوقهم والأولاد حقوقهم والجيران حقوقهم والطلبة حقهم والشيخ حقه والعمل حقه والدنيا حقها وهكذا ، فهذا أصعب واجب والموفق من وفقه الله .

محمد جديدي التبسي
2012-02-07, 10:43
التأثير في الناس وكسب محبتهم أسهل مما تتصور ..!
لا أبالغ في ذلك فقد جربته مراراً .. فوجدت أن قلوب أكثر الناس يمكن صيدها بطرق ومهارات سهلة .. بشرط أن نصدق فيها ونتدرب عليها فنتقنها ..
والناس يتأثرون بطريقة تعاملنا .. وإن لم نشعر ..
أتولى منذ ثلاث عشرة سنة الإمامة والخطابة في جامع الكلية الأمنية ..
كان طريقي إلى المسجد يمر ببوابة يقف عندها حارس أمن يتولى فتحها وإغلاقها ..
كنت أحرص إذا مررت به أن أمارس معه مهارة الابتسامة .. فأشير بيدي مسلماً مبتسماً ابتسامة واضحة .. وبعد الصلاة أركب سيارتي راجعاً للبيت ..
وفي الغالب يكون هاتفي المحمول مليئاً باتصالات ورسائل مكتوبة وردت أثناء الصلاة .. فأكون مشغولاً بقراءة الرسائل فيفتح الحارس البوابة وأغفل عن التبسم ..
حتى تفاجأت به يوماً يوقفني وأنا خارج ويقول : يا شيخ ..! أنت زعلان مني ؟!
قلت : لماذا ؟
قال : لأنك وأنت داخل تبتسم وتسلم وأنت فرحان .. أما وأنت خارج فتكون غير مبتسم ولا فرحان !!
وكان رجلاً بسيطاً .. فبدأ المسكين يقسم لي أنه يحبني ويفرح برؤيتي ..
فاعتذرت منه وبينت له سبب انشغالي ..
ثم انتبهت فعلاً إلى أن هذه المهارات مع تعودنا عليها تصبح من طبعنا .. يلاحظها الناس إذا غفلنا عنها ..

إضاءة ..

لا تكسب المال وتفقد الناس .. فإن كسب
الناس طريق لكسب المال ..


فأنت إذا أردت أن تكون رأساً لا ذيلاً .. احرص على تتبع المهارات أينما كانت .. درِّب نفسك عليها ..
كان عبد الله رجلاً متحمساً .. لكنه تنقصه بعض المهارات .. خرج يوماً من بيته إلى المسجد ليصلي الظهر .. يسوقه الحرص على الصلاة ويدفعه تعظيمه للدين ..
كان يحث خطاه خوفاً من أن تقام الصلاة قبل وصوله على المسجد ..
مر أثناء الطريق بنخلة في أعلاها رجل بلباس مهنته يشتغل بإصلاح التمر ..
عجب عبد الله من هذا الذي ما اهتم بالصلاة .. وكأنه ما سمع إذاناً ولا ينتظر إقامة ..!!
فصاح به غاضباً : انزل للصلاة ..
فقال الرجل بكل برود : طيب .. طيب ..
فقال : عجل .. صل يا حمار !!
فصرخ الرجل : أنا حمار ..!! ثم انتزع عسيباً من النخلة ونزل ليفلق به رأسه !!
غطى عبد الله وجهه بطرف غترته لئلا يعرفه .. وانطلق يعدو إلى المسجد ..
نزل الرجل من النخلة غاضباً .. ومضى إلى بيته وصلى وارتاح قليلاً .. ثم خرج إلى نخلته ليكمل عمله ..
دخل وقت العصر وخرج عبد الله إلى المسجد ..
مرّ بالنخلة فإذا الرجل فوقها ..
فقال : السلام عليكم .. كيف الحال ..
قال : الحمد لله بخير ..
قال : بشر !! كيف الثمر هذه السنة ..
قال : الحمد لله ..
قال عبد الله : الله يوفقك ويرزقك .. ويوسع عليك .. ولا يحرمك أجر عملك وكدك لأولادك ..
ابتهج الرجل لهذا الدعاء .. فأمن على الدعاء وشكر ..
فقال عبد الله : لكن يبدو أنك لشدة انشغالك لم تنتبه إلى أذان العصر !! قد أذن العصر .. والإقامة قريبة .. فلعلك تنزل لترتاح وتدرك الصلاة .. وبعد الصلاة أكمل عملك .. الله يحفظ عليك صحتك ..
فقال الرجل : إن شاء الله .. إن شاء الله ..
وبدأ ينزل برفق .. ثم أقبل على عبد الله وصافحه بحرارة .. وقال : أشكرك على هذه الأخلاق الرائعة .. أما الذي مر بي الظهر فيا ليتني أراه لأعلمه من الحمار !!


مهاراتك في التعامل مع الآخرين .. على أساسها تتحدد طريقة تعامل الناس معك ..

للشيخ محمد العريفي

بارك الله فيك أختي الفاضلة
والله موضوع رائع فعلا
من خلال حياتي اليومية أرى أثر الابتسامة والكلمة الطيبة على النفوس
هناك أناس نحبهم فقط لما ننظر إليهم من دون أن نعرفهم أو نتحدث معهم.
جزاك الله خيرا أختي وزيدينا من فوائدك الطيبة
شكرا جزيلا لك

شكرا أختي معا إلى الله على الدعاء الجميل
وأتمنى أن تكوني بخير ونرى أطباق متنوعة جميلة من المأكولات والحلويات
وكذا الفوائد العلمية المختلفة

عطر الملكة
2012-02-07, 11:13
اسعد الله اوقات الجميع

عطر الملكة
2012-02-07, 11:18
لا أبدن لم نتكلم علي فرنسا هي قد جائة للجزائر للعمل لأن في فرنسا عائلتها في أزمة كبيرة و لهم ديون

أنا عندي عمل هنا و أنا وحيد عند عائلتي قد قلت لعائلتها مرارا لا أتي إلي فرنسا لأن هم من كانو يقولو لي تعال إلي فرنسا و أنا قلة لا
أنا عندي الكتير من أفراد عائلتي في فرنسا لو أردة الذهاب هناك لتزوجة بأحد بناتهم كلهم يبحتون عن زواج

أنا الحمد لله أعيش جيدا في الجزائر ما يخصني والو الحمد لله

البنت ضربة و هددة و قد قلبو عقلها أم البنت شيطانة و نمامة كبيرة هي من خلقة المشكل و قد قلبة كل واحد ضد الأخر
سياسة فرق تسد
حسبي الله و نعم الوكيل على من ضلمني و على كل من أراد بي السوء

طالما كانت نيتك حسنة وكل الله عليهم
فعلا يوجد هذ النوع من الامهات يخربوا على بناتهم الله يبعد شرهم
انت اترك المحامي يتابع امورك و ان شاء الله ربي يصلح الحال

محمد جديدي التبسي
2012-02-07, 11:34
قال عمر بن الخطاب رضى الله عنه :

لاتتفكــر فى ثــلاثة أشيـــاء:

فى الفقر فيكثر ...همــك وغمــك ويزيــد فـى حرصــك.

ولا تتفكر فيمن ظلمك فيغتاظ قلبك ويكثر حقدك ويدوم غيظك.

ولا تفكر فى طول البقاء فى الدنيا فتحب الجمع وتضيع العمر وتسوّف فى العمل

•––––ılılı.ılılı.ılılı... قلب يحيا بحب الله ...ılılı.ılılı.ılılı––––•

عطر الملكة
2012-02-07, 11:45
هي بالذات و الصفات .. air de france :1:
حومتي .. http://www.djelfa.info/vb/images/icons/icon10.gif
لا تقولي كنتِ تمرّين من هنآك ؟ واش من عوام ؟
ربّما تلاقينا .. من يدري ... :rolleyes:


أمّآ فيمآ يخصّ الأعرآس عندنآ ..
صحيح .. كلّ أعراسنا في les salle des fetes
ولّآت عادة .. تلقاي مام لي عندو ليـــستع
لكن يفضّلهآ .. لما فيها من خدمات و راحة ..

و العرس يبدى حوالي الوحدة زوالا ..
بحيث يبدى الديسك جوكي .. [ الله يهدينا ] ..
و يبدأ الضيوف في التوافد ..

في انتظآر قدوم العروسة .. التي تأتي من عند الحفافة ..

و تدخل بالطايور أبيض ..
تجلس مباشرة على كرسي التصديرة ..
و بعد لحظىت تأتي لي تصدّرها تشدها و تدوّرها على الغاشي ..
و ترجعها لغرفة التبديل ..

و هكذا يستمرّ عرض الأزياء .. حسب الألبسة التي اختارت العروس أن تظهر بهآ ..

كاين لي يوصل أكثر من 10 تبديلات ..
و ماشي شرط تخلعي و تقولي منين جاوها ..

فيوجد من تكريهآ أو تقرضهآ من عند الأقارب .. :1:

المهم ..
في تلك الأحيان لي تتصدر العروسة ..
يساربيو القازوز أولا مع ما يرافقه من حلوى [ كيش أو رولي ] ..

و كاين لي يديرو المثلجات .. [زعمة اقتصاد] .. :rolleyes:

و بعدها بمدّة يساربيو القهوة مع علب القاطو ..
و القاطو حكاية أخرى .. :1:

و في الأخير يساربيو الشاي مع الحلوى المعسلة المصاحبة له ..

في هاذاك الوقت تكون الساعة تشير الى حوالي بين الخامسة الى السادسة
يبدى الغاشي يروح ..

و آخر تصديرة للعروسة هي
la robe blanche
تلبسها .. و الديسك جوكي يدير أغنية تبكي و تقطّع القلب .. :1:

و الله الدموع يطيحو بلا ما تحبي ..

مطلعهـــآآآآ >>>

**اليوم يوم لهنا .. يا ناس هنونا .. بعد ما تهنونا روحوا و خليونا…
بنتي يا بنتي يا مفتاح البيت خدمتي على لميمة(الام) و ما قولتيش عييت(تعبت) ……الخ الخ**

و كاين لي يدير الزرنة ..

و تبدى العروس و أهلها يتباكاو ... :cool:

و يعطوها سلّة الدراجي .. مشبحين بالورود و مختلف الأشكال ..
و توزعها هي بنفسها على المعازيم ..

و من بعد يبقاو شويّة و يروحو يتعشاو ..

عادة طعام مرقة حمراء .. + دلاع أو عنب + قازوز
و خطرات .. شربة + طبق جانبي .. + ديسار ..


أما ذهاب العروسة لبيت العريس ..
فغالبا ليس في الغد .. بل بعد أسبوع .. و أحيانا أكثر .. :rolleyes:

هذا باختصار .. و ان شاء الله مزال نزيد نحكيلكم على بزّآآآف أمور .. :19:

نعم هي Air de France كنت امر يوميا من هناك و اذهب لأحد الاسواق المغطاة هناك و احيانا مع صديقاتي في الويكاند خاصة نمر من هناك و نذهب مشي حتى لشوفالي تغيير جو يعني و كانت هناك حلاقة بشوفالي مرة من المرات قطعت شعري عندها ههههههههههههه
كان ذلك بسنة 1997 - 1998
كانت ايام حلوة و بوزريعة منطقة عالية و باردة لكن تعجبني هادئة ما فيها كثير ضجة العاصمة

اما بخصوص الاعراس صح كلامك
انا العرس الي حضرتوا داروا فيه نفس الشي الي حكيتيه
و انا وقتها مع نسوان من عائلتي لبسنا لباسنا التقليدي روبا نائلي مع اكسسوراتها بما فيها السخاب
الكل اعجب بلباسنا حتى اني اذكر وقتها اخذت معي سيدي نائلي و رقصنا نائلي و حاولوا النسوان الحاضرات يقلدوا رقصنا اعجبهم كثير لكن شويا ما عرفوش ههههههههههههههههه رقصنا زين بصح صعيب شويا
كنت انا و البنات الي معايا وقتها اكثر بنات مميزات لاننا الوحيدين الي كنا لابسين لبس تقليدي باقي البنات كامل لابسين عالموضة
و نقلك الصح اكثر شي اعجبني هو انهم الي ماسكين الدي جي كانوا يحطوا كثير الاغاني العاصمي انا نموت على الحوزي الخفيف
نشفى وقتها استمتعت كثير
و الحلويات و الله رائعة رائعة رائعة لحد الآن طعمها و شكلها امام عيني
اما الكسكس بصراحة ما عجبني لانو احنا متعودين على الكسكس النائلي مسقي بالدهان و مرقتو معقرة و طايبة بلحم الغنمي
و مع ذلك لا يهم الاكل كل منطقة و تقاليدها الاجواء كانت اكثر من رائعة و التنظيم جيد
و الناس الي راحوا معايا ما كانوش عارفين انو العرس عندكم هو امسية فقط استغربوا كثير لما الناس بدات تتفرق مع اخر العشية
على خاطر اعراس اولاد نائل احنا الناس تجي من الصبح و يقعدوا كامل يتعشاوا العرس النائلي يفرق عن العرس العاصمي كونه يتكلف في مقامة العشاء
اما بخصوص التصديرة عجبتني كانت كلها من تقاليدنا نشفى وقتها عجبتني الحطة نتاع الكاراكو و الله خدمة نتاع مجبود متقونة
و بخصوص موضوع كثرة التصديرة احنا حاليا عندنا ما عادوش يكثروا اللبس ياسر من 4 حتى 6 روبات شابين
و تعرفي حتى هنا في الجلفة في السنوات الاخيرة راهم عادوا العائلات يديروا اعراسهم اما بفندق او قاعة حفلات او يكروا سكن مخصص فقط لاقامة الاعراس كل واحد و الاستطاعة نتاعوا بصح بيني و بينك هاك خير خير ما الواحد يدير عرس في داروا و يحصل من بعد في مخلفات العرس
العرس في القاعات يجي منظم و زين

2012-02-07, 11:49
السلام عليكم

اسعدتم مساء ايها الافاضل ايتها الفضليات ..

..كاش ثلج :1:حنا جابلي ربي رانا تحت مستوى البحر، الدنيا كلها ثلج وحنا مكان والو :1:
احب ان اسمع منكم
هل الزوجة هي من تصلح زوجها او العكس ؟؟ ام كل منهما يصلح الاخر ؟؟


عطر الملكة
2012-02-07, 12:06
السلام عليكم

اسعدتم مساء ايها الافاضل ايتها الفضليات ..

..كاش ثلج :1:حنا جابلي ربي رانا تحت مستوى البحر، الدنيا كلها ثلج وحنا مكان والو :1:
احب ان اسمع منكم
هل الزوجة هي من تصلح زوجها او العكس ؟؟ ام كل منهما يصلح الاخر ؟؟


و عليكم السلام و الرحمة و الاكرام
يسعد مساك

بخصوص الثلج عندنا في الجلفة حبس لكن برد يقطع و رياح قاوية من مبارح
و انت و ين منطقة راك تسكن حتى ما صبش عندكم !!!!!!!!!!!!!!!!!!!!؟؟؟؟؟؟
بخصوص سؤالك
حسب طبيعة الأشخاص الامر نسبي نوعاما
واقعيا كثير زوجات غيروا كثير من عقلية ازواجهن يعني مثلا قبل الزواج كان كثير الاصحاب يقضي معظم اوقاته خارج البيت يجمع كثير في المقاهي و ما شابه ذلك من بعض التصرفات التي يشترك فيها اغلب العزابية
لكن بمجرد زواجهم تغيروا تماما 180 درجة
و نزيدك حاجة و هذي من الواقع كم من زوجة كانت سبب في توبة بعض الرجال عن بعض السلوكات السيئة التي كانوا يقومون بها قبل الزواج
و كم من زوجة كانت وجه خير على زوجها بل كم من زوجة ساعدت زوجها و خرجاتوا من الغرقة و بعد ما كان يتخبط في الفقر اصبح سي فلان
و نفس الشي حدث مع بنات كم من بنت كانت ربما في طريق ضلال و طاحت مع رجل ولد فاميليا غيرلها تماما من شخصيتها
و كاين الوضع العكسي
كم من زوج كان من احسن الناس لكن بمجرد ارتباطه مع امرأة ما تغير للاسوء
الحق يقال الامر نسبي و تجارب الناس تختلف لا يمكن ان نخرج بنتائج مضبوطة
ربي خلق و فرق
شكرا اخي وحيد
على المشاركة القيمة

نور الايام
2012-02-07, 12:11
السلام عليكم

اسعدتم مساء ايها الافاضل ايتها الفضليات ..

..كاش ثلج :1:حنا جابلي ربي رانا تحت مستوى البحر، الدنيا كلها ثلج وحنا مكان والو :1:
احب ان اسمع منكم
هل الزوجة هي من تصلح زوجها او العكس ؟؟ ام كل منهما يصلح الاخر ؟؟


و عليكم السلام و رحمة الله و بركاته

اليوم وين خرجت كيما مشيت صب شوية و حد 4 ثواني :1: قلت و اخيرا ظهر بعدها اتخفى تماما و اتغلبت اعليه الامطار ،صديقتي قالتلي هذا جابوا غير الريح ماكان والو :)

بالنسبة للسؤال أكيد اخي وحيد كلاهما يصلح الآخر و عيوب ذاك ليست عيوب تلك الا أنه غالبا ما أرى و أسمع أن صلاح المرأة يؤثر في الرجل و قابلية التغيير نحو الأحسن تكون عنده أكثر.

و يبقى الهدف الحقيقي من الزواج هو اعانة كلاهما الآخر على طاعة لله

بالتوفيق ان شاء الله و جزاك الله خيرا.

نور الايام
2012-02-07, 12:13
بالمناسبة أختي عطر الملكة كان الله في عون لوحة مفاتيحك و كذلك أختي معا الى الله :1:

تحية لكما على السريع :)

عطر الملكة
2012-02-07, 12:16
بالمناسبة أختي عطر الملكة كان الله في عون لوحة مفاتيحك و كذلك أخي معا الى الله :1:

تحية لكما على السريع :)

يسعد مساك غاليتي


لهذه الاسباب و من اجلها لو تشوفي لي كلافي الخاسرين عندي تدوخي ههههههههههههههههههههه
لوحة المفاتيح عندي راها تعاني

2012-02-07, 12:18
و عليكم السلام و الرحمة و الاكرام
يسعد مساك

بخصوص الثلج عندنا في الجلفة حبس لكن برد يقطع و رياح قاوية من مبارح
و انت و ين منطقة راك تسكن حتى ما صبش عندكم !!!!!!!!!!!!!!!!!!!!؟؟؟؟؟؟
بخصوص سؤالك
حسب طبيعة الأشخاص الامر نسبي نوعاما
واقعيا كثير زوجات غيروا كثير من عقلية ازواجهن يعني مثلا قبل الزواج كان كثير الاصحاب يقضي معظم اوقاته خارج البيت يجمع كثير في المقاهي و ما شابه ذلك من بعض التصرفات التي يشترك فيها اغلب العزابية
لكن بمجرد زواجهم تغيروا تماما 180 درجة
و نزيدك حاجة و هذي من الواقع كم من زوجة كانت سبب في توبة بعض الرجال عن بعض السلوكات السيئة التي كانوا يقومون بها قبل الزواج
و كم من زوجة كانت وجه خير على زوجها بل كم من زوجة ساعدت زوجها و خرجاتوا من الغرقة و بعد ما كان يتخبط في الفقر اصبح سي فلان
و نفس الشي حدث مع بنات كم من بنت كانت ربما في طريق ضلال و طاحت مع رجل ولد فاميليا غيرلها تماما من شخصيتها
و كاين الوضع العكسي
كم من زوج كان من احسن الناس لكن بمجرد ارتباطه مع امرأة ما تغير للاسوء
الحق يقال الامر نسبي و تجارب الناس تختلف لا يمكن ان نخرج بنتائج مضبوطة
ربي خلق و فرق
شكرا اخي وحيد
على المشاركة القيمة

جميل جدا حضرة المحامية
الا تعتقدين ان الامر مرتبط بمدى قالبيلة الانسان بالتغيير اي مرتبط اساسا بعقل الانسان
والرجل اكثر قابلية في التغيير لانه يملك عقلا اكثر تفوقا من المراة
والمراة اذا كانت خبيثة فمن الصعب او المستحيل اصلاحها
عموما افهم من كلامك
ان المراة هي االاكثر تاثيرا على الرجل والواقع يثبت ذلك
نسكن في تيبازة .......تحت مستوى البحر ههههههههه
بارك الله فيك اختي

2012-02-07, 12:29
نسكن في تيبازة .......تحت مستوى البحر ههههههههه
بارك الله فيك اختي

والله اعلم ان مدينة تيبازة لم تصلها الثلوج ..... راهو مازال كاين لاصق الثلج عندنا ارواح لينا ونعطولك شوي ونضربوك بكرة ثلج .......

محمد جديدي التبسي
2012-02-07, 12:37
عــنــدمــا نــقــف أمــام عــدســات [الــتــصــويــر]

فــإنّــنــا نــبــدأ فــي تــحــســيــن مــظــهــرنــا

لــتــبــدو الــصّــورة أكــثــر جــمــالا لــنــاظــرهــا

" " فــمــا بــالــكـ

و أنّ "الــلّــه سبحــانه"

دومــا يـــراكـ و يــطّــلــع عــلــى أعــمــالــكـ و أقــوالــكـ و أفــعــالــك

و حــتــى نــوايــاك و ســريــرتــكـ و قــلــبــكـ ؟

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/p480x480/428989_226923814067207_100002487701654_513128_1806 823199_n.jpg

محمد جديدي التبسي
2012-02-07, 12:41
- احـــذر فرقعة الاصابع

- تسبب أضرار بالغة في أربطة ومفاصل الأصابع و الصوت المرتفع لفرقعة الأصابع يكون ناتجاً عن انخفاض حاد في الضغط خلال كبسولة المفصل
تتسبب في تكوين فقاعة من السائل حول المفصل.
- خلل مزمن في المفصل فيجعل الشخص غير قادر على تحريك الاصابع بعد مرور فترة زمنية بسيطة
اذا كان مكثرا من فرقعة الاصابع

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/417968_226922960733959_100002487701654_513124_3522 63689_n.jpg

عطر الملكة
2012-02-07, 12:52
جميل جدا حضرة المحامية
الا تعتقدين ان الامر مرتبط بمدى قالبيلة الانسان بالتغيير اي مرتبط اساسا بعقل الانسان
والرجل اكثر قابلية في التغيير لانه يملك عقلا اكثر تفوقا من المراة
والمراة اذا كانت خبيثة فمن الصعب او المستحيل اصلاحها
عموما افهم من كلامك
ان المراة هي االاكثر تاثيرا على الرجل والواقع يثبت ذلك
نسكن في تيبازة .......تحت مستوى البحر ههههههههه
بارك الله فيك اختي

و الله يا اخي وحيد صحيح قابلية الانسان للتغيير لها دور من حيث الوقت و من حيث الجهد المبذول من اجل التغيير
لكن فكرة ان الرجل يملك عقلا اكثر تفوق من المرأة فلا يوجد اي دليل على ذلك لا شرعا و لا علميا ولا تقلي النساء ناقصات عقل و دين لان الكل فاهم معنى الحديث فلا داعي للدخول في تلك التفاصيل ...............
واقعيا المراة وصل مستوى تفوقها على الرجل لدرجة انها درست مجالات الرجل نفسه لم ينجح فيها و دخلت حتى في اعمال كثير رجال لم يدخلوها يعني القدرات العقلية للانسان لا علاقة لها بذلك
اذا تكلمنا عن القدرات العقلية للمرأة علميا اثبت ان المرأة بامكانها ان تعمل كذا عمل في وقت واحد فقد تجدها تحمل رضيعها و عينها على التلفزيون و ربما فاتحة موضوع تتكلم فيه و مركزة على كل هذه الامور في حين الرجل لا يمكنه التركيز على اكثر من عمل في وقت واحد
نأتي لتأثير المرأة على الرجل واقعيا نعم تأثر تأثير كبير
الرجل بطبعه ضعيف امام المرأة فما بالك لو ان هذ المرأة على قدر من الجمال و الدهاء و حلاوة لسان من المؤكد انه سيصبح خاتم في اصبعها تلقائيا ومن غير ما يشعر انه تغير و انه تحت تأثيرها
كم من عائلة كانت متماسكة و متحابة و بدخول امرأة ما اصبح كل واحد في جهة بل انه كثير منهم دخلوا مع بعض في محاكم بسبب الميراث و المادة و السبب الرئيسي وراء ذلك هو تخطيط النساء
كيدنا عظيم يا اخي فلا تقلل من مستوى تفكير المرأة و لتعلم ان المرأة اذا كان قلبها فارغ من الايمان و خوف الله صدقني هي قادرة على فعل الكثير الكثير لهذا الرسول صلى الله عليه و سلم امر بالارتباط بذات الدين
و اكبر دليل على كلامي قصة السيدة زليخة مع سيدنا يوسف و كيدها و كيد نساء مصر كان من منطلق انهن لم يكن على ايمان ولا على معرفة بالله
لذلك ان غاب الايمان و خوف الله عن المرأة فلا تستغرب و لا تتعجب مما قد يحدث !!!!!!!!!!
اضافة ان تأثر الام عن البنت و تربيتها سيجعل منها نسخة من امها
لذلك الانسان لما يقدم على خطبة امرأة ما يتوجب عليه ايضا ان يتحرى بعض الشيء عن الام
لا ادري ان كنت قد وصلت فكرتي
لكن ثق تماما ان المرأة اقدر على التغيير من الرجل

سآجدْ للهْ
2012-02-07, 13:15
أسعد الله صبآح الجميع ..
كيفكم ؟ .. ان شاء الله بألف خير ..


أخي عقبة :

جزآك الله خيرآ على الفوآئد التي جمّلتَ بهآ دآرنآ ..
و صلى الله على محمّد و سلم تسليمآ ..

و الله لنحن ندعو الله ان يجعلك صالحآ و قدوة للشباب الذين في سنّك ..
حماك الله و رعاك و ثبّتك ..

أما بالنسبة للحلقآت .. فانها فعلا مشوّقة ..
لي عودة لقراءتها بتمعن ان شاء الله ..


و الله كم هائل و وآفر من الفوآئد ..
قرأتُ البعض منه و الآخر سأفعل ان شاء الله ..

و ان شاء الله لا يؤثّر سهرك معنآ على نومك و دراستك ..

شكرا و ألف ألف ألف شكر أخونآ ..
فعلآ أفدتنآ أفادك الله و نوّرك ..

[ :) فقط حآول أن تتريث بن 3 فوائد و اربعة .. حتى يتسنى لنا القراءة و التمعن ..و الاستفادة ..:rolleyes: و كي لا تفوتنا من تلك الفوائد شيء :) ]



|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
صلى الله عليه وسلم

جزيت بالمثل ان شااء الله

امين امين امين
ان شااء الله سأتريث بين كل 2 و3 فوائد :19:
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
بارك الله فيك أخي الفاضل "عقبة"
جزاك الله خيرا على الفوائد القيمة
أظن أنه عندك موضوع فيه أمثلة كثيرة من هذه الفوائد وقد اطلعت على صفحات منه ولكني لم أجده بعدها فحبذا لو تضع لنا رابطه لنستفيد منه
ربي يحفظك ويبارك فيك ويجعلك من أصحاب الجنة
شكرا جزيلا لك أخي الكريم
ولا تحرمنا من فوائدك
أنسيت أن أقول: السلام عليكم ورحمة الله وبركاته
على الدار وأهلها الكرام
بارك الله فيكم ووفقكم لكل خير

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
وعليكم السلام
وفيك البركه اخي محمد
جزيت بالمثل ان شااء الله
وهاهو ذا الموضوع الذي طلبتــــه :

| مقتطفات | متجدده بإذن الله .. (http://www.djelfa.info/vb/showthread.php?t=805468) ‏(http://www.djelfa.info/vb/images/misc/multipage.gif 1 (http://www.djelfa.info/vb/showthread.php?t=805468) 2 (http://www.djelfa.info/vb/showthread.php?t=805468&page=2) 3 (http://www.djelfa.info/vb/showthread.php?t=805468&page=3) ... الصفحة الأخيرة (http://www.djelfa.info/vb/showthread.php?t=805468&page=9))
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-07, 13:37
و عليكم السلام و رحمة الله و بركآته ..
أنت كي جيت حنا كنّآ رحنآ .. :1:
وآش وين كنت .. وقيل كنت مع الثلج ... :rolleyes:

موفّق في الدراسة ان شاء الله .. :mh31:

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
هيه كنت مع الثلج هههه..

ان شااء الله

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

محمد جديدي التبسي
2012-02-07, 13:47
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
وعليكم السلام
وفيك البركه اخي محمد
جزيت بالمثل ان شااء الله
وهاهو ذا الموضوع الذي طلبتــــه :

| مقتطفات | متجدده بإذن الله .. (http://www.djelfa.info/vb/showthread.php?t=805468) ‏(http://www.djelfa.info/vb/images/misc/multipage.gif 1 (http://www.djelfa.info/vb/showthread.php?t=805468) 2 (http://www.djelfa.info/vb/showthread.php?t=805468&page=2) 3 (http://www.djelfa.info/vb/showthread.php?t=805468&page=3) ... الصفحة الأخيرة (http://www.djelfa.info/vb/showthread.php?t=805468&page=9))
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
بارك الله فيك أخي عقبة
هذا هو ما كنت أبحث عنه بالذات
جزاك الله خيرا أخي وجعل ما تنشره في ميزان حسناتك
ولعلمك فإني أنشرها عندي ويستفيد منها الكثير
شكرا جزيلا لك أخي العزيز

هيا الجزائر
2012-02-07, 14:04
السلام عليكم ورحمة الله وبركاته
ان شاء الله الجميع بخير
فلن احدد اخاف ان انسى واحد منكم يا رواد الدار الداركم

اللهمَ أرزقِنــًــَآ مٱنُــرِيـــدّ ...
ۆآرزقّ قٍــلۆبُنــــــَآ مٱتُــرِيـد ...
ۆآجَعْلنــَآ لـگَ گــمْآ تُــرِيدّ ♥

هيا الجزائر
2012-02-07, 14:07
أحلى هدية مني


سآجدْ للهْ
2012-02-07, 14:09
بارك الله فيك أخي عقبة
هذا هو ما كنت أبحث عنه بالذات
جزاك الله خيرا أخي وجعل ما تنشره في ميزان حسناتك
ولعلمك فإني أنشرها عندي ويستفيد منها الكثير
شكرا جزيلا لك أخي العزيز

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

وفيك البركة
امين امين

جزاك الله خيراا محمد

موفق إن شااء الله
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-07, 14:15
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
بسم الله الرحمن الرحيم
و الصـلآة و السـلآم على أشـرف المرسليـن

السلام عليكم ورحمة الله تعالــى وبركاته :

لقد جمعت لكم فــيـ هذا الموضوع اكبر عدد ممكن من الصور

الرمزية الدعوية + التواقيع الدعوية

[[ اكثر من 110 صورة دعوية ]]
















































































































|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

معاً إلى الله
2012-02-07, 14:19
بارك الله فيك أختي الفاضلة

والله موضوع رائع فعلا
من خلال حياتي اليومية أرى أثر الابتسامة والكلمة الطيبة على النفوس
هناك أناس نحبهم فقط لما ننظر إليهم من دون أن نعرفهم أو نتحدث معهم.
جزاك الله خيرا أختي وزيدينا من فوائدك الطيبة
شكرا جزيلا لك

شكرا أختي معا إلى الله على الدعاء الجميل
وأتمنى أن تكوني بخير ونرى أطباق متنوعة جميلة من المأكولات والحلويات
وكذا الفوائد العلمية المختلفة

مرحبآ أخي الكريم ..
الحمد لله نحن بخير و لله الشكر و الحمد ..
و مآ أبعدنا عن الدّآر إلّى بعض الأولويات و الضروريّآت ..
نسأل الله أن يعيننا في حياتنا و أن يوفّقنا لما يحبّه و يرضاه عنّآ ..

إنّه وليّ ذلك ..

اسعد الله اوقات الجميع

و طآب نهآرك أختي الكريمة ..
ان شاء الله تكون أحوالكم بألف خير ..


طالما كانت نيتك حسنة وكل الله عليهم
فعلا يوجد هذ النوع من الامهات يخربوا على بناتهم الله يبعد شرهم
انت اترك المحامي يتابع امورك و ان شاء الله ربي يصلح الحال

اللهم آمين يا رب العالمين ..
اللهمّ اجزنآ بحسن نيّآتنآ ..

قال عمر بن الخطاب رضى الله عنه :

لاتتفكــر فى ثــلاثة أشيـــاء:

فى الفقر فيكثر ...همــك وغمــك ويزيــد فـى حرصــك.

ولا تتفكر فيمن ظلمك فيغتاظ قلبك ويكثر حقدك ويدوم غيظك.

ولا تفكر فى طول البقاء فى الدنيا فتحب الجمع وتضيع العمر وتسوّف فى العمل

•––––ılılı.ılılı.ılılı... قلب يحيا بحب الله ...ılılı.ılılı.ılılı––––•

أحبّك ربّي .. لا اله الا الله محمّد رسول الله صلّى الله عليه و سلّم .. :)

نعم هي Air de France كنت امر يوميا من هناك و اذهب لأحد الاسواق المغطاة هناك و احيانا مع صديقاتي في الويكاند خاصة نمر من هناك و نذهب مشي حتى لشوفالي تغيير جو يعني و كانت هناك حلاقة بشوفالي مرة من المرات قطعت شعري عندها ههههههههههههه
كان ذلك بسنة 1997 - 1998
كانت ايام حلوة و بوزريعة منطقة عالية و باردة لكن تعجبني هادئة ما فيها كثير ضجة العاصمة

اما بخصوص الاعراس صح كلامك
انا العرس الي حضرتوا داروا فيه نفس الشي الي حكيتيه
و انا وقتها مع نسوان من عائلتي لبسنا لباسنا التقليدي روبا نائلي مع اكسسوراتها بما فيها السخاب
الكل اعجب بلباسنا حتى اني اذكر وقتها اخذت معي سيدي نائلي و رقصنا نائلي و حاولوا النسوان الحاضرات يقلدوا رقصنا اعجبهم كثير لكن شويا ما عرفوش ههههههههههههههههه رقصنا زين بصح صعيب شويا
كنت انا و البنات الي معايا وقتها اكثر بنات مميزات لاننا الوحيدين الي كنا لابسين لبس تقليدي باقي البنات كامل لابسين عالموضة
و نقلك الصح اكثر شي اعجبني هو انهم الي ماسكين الدي جي كانوا يحطوا كثير الاغاني العاصمي انا نموت على الحوزي الخفيف
نشفى وقتها استمتعت كثير
و الحلويات و الله رائعة رائعة رائعة لحد الآن طعمها و شكلها امام عيني
اما الكسكس بصراحة ما عجبني لانو احنا متعودين على الكسكس النائلي مسقي بالدهان و مرقتو معقرة و طايبة بلحم الغنمي
و مع ذلك لا يهم الاكل كل منطقة و تقاليدها الاجواء كانت اكثر من رائعة و التنظيم جيد
و الناس الي راحوا معايا ما كانوش عارفين انو العرس عندكم هو امسية فقط استغربوا كثير لما الناس بدات تتفرق مع اخر العشية
على خاطر اعراس اولاد نائل احنا الناس تجي من الصبح و يقعدوا كامل يتعشاوا العرس النائلي يفرق عن العرس العاصمي كونه يتكلف في مقامة العشاء
اما بخصوص التصديرة عجبتني كانت كلها من تقاليدنا نشفى وقتها عجبتني الحطة نتاع الكاراكو و الله خدمة نتاع مجبود متقونة
و بخصوص موضوع كثرة التصديرة احنا حاليا عندنا ما عادوش يكثروا اللبس ياسر من 4 حتى 6 روبات شابين
و تعرفي حتى هنا في الجلفة في السنوات الاخيرة راهم عادوا العائلات يديروا اعراسهم اما بفندق او قاعة حفلات او يكروا سكن مخصص فقط لاقامة الاعراس كل واحد و الاستطاعة نتاعوا بصح بيني و بينك هاك خير خير ما الواحد يدير عرس في داروا و يحصل من بعد في مخلفات العرس
العرس في القاعات يجي منظم و زين

و هو كذلك .. فتلك المنطقة بآردة جدّآ ..
و لو تزورها الآن لتندهشين من جمالها أكثر من ذي قبل .. :19:
فقد أجروا عدّة تعديلات فيها ..

بوزريعة البلدية تقع في الشمال الغربي لولاية العاصمة الجزائر اي وسط الولاية وهي باردة جدا نظرا لارتفاعها 400 م عن سطح البحر. بها يقع المرصد الفلكي للجزائر ومعهد البحوث الفلكية والأسطروفيزيائية والجيوفيزيائية. مركز الفضاء الجزائري وجامعة الجزائر (ملحقة العلوم الإنسانية). و غابة باينام أكبر غابات مدينة الجزائر.
يوجد ببوزريعة كل من قنصلية النيجروعمانوموريتانيا

السلام عليكم

اسعدتم مساء ايها الافاضل ايتها الفضليات ..

..كاش ثلج :1:حنا جابلي ربي رانا تحت مستوى البحر، الدنيا كلها ثلج وحنا مكان والو :1:
احب ان اسمع منكم
هل الزوجة هي من تصلح زوجها او العكس ؟؟ ام كل منهما يصلح الاخر ؟؟


و عليكم السلام و رحمة الله و بركاته ..

مرحبآ بعودتك أخونا الكريم [ وحيد ] .. :mh31:
طاب مساؤك و مساء الجميع ..

عن سؤالك أجيب و أقول ..
قادرة المرأة تصلح زوجهآ .. كيما قادر الراجل يصلح زوجته ..
الأمر يتوقّف على عزيمة و ارادة كلّ واحد منهمآ ..
في تحقيق نتيجة ايجابيّة ..
و أكيد من جدّ وجد .. و المجهوذات لن تذهب سدى ..
فقط على المصلح أن يكون صالحآ في حدّ ذاته ..
و يكون قدوة لغيره ..

يقول ربّي و ربّك :
** إنّك لا تهدي من أحببت .. لكن الله يهدي من يشاء ..
هو أعلم بالمهتدين **

فكلمة يشاء تعود للشخص الذي يطمح للهداية
فأن الله سوف يرزقه الهداية ..

و من اهتدى صلـُح أمره باذن الله ..

بارك الله فيك ..

و عليكم السلام و الرحمة و الاكرام
يسعد مساك

بخصوص الثلج عندنا في الجلفة حبس لكن برد يقطع و رياح قاوية من مبارح
و انت و ين منطقة راك تسكن حتى ما صبش عندكم !!!!!!!!!!!!!!!!!!!!؟؟؟؟؟؟
بخصوص سؤالك
حسب طبيعة الأشخاص الامر نسبي نوعاما
واقعيا كثير زوجات غيروا كثير من عقلية ازواجهن يعني مثلا قبل الزواج كان كثير الاصحاب يقضي معظم اوقاته خارج البيت يجمع كثير في المقاهي و ما شابه ذلك من بعض التصرفات التي يشترك فيها اغلب العزابية
لكن بمجرد زواجهم تغيروا تماما 180 درجة
و نزيدك حاجة و هذي من الواقع كم من زوجة كانت سبب في توبة بعض الرجال عن بعض السلوكات السيئة التي كانوا يقومون بها قبل الزواج
و كم من زوجة كانت وجه خير على زوجها بل كم من زوجة ساعدت زوجها و خرجاتوا من الغرقة و بعد ما كان يتخبط في الفقر اصبح سي فلان
و نفس الشي حدث مع بنات كم من بنت كانت ربما في طريق ضلال و طاحت مع رجل ولد فاميليا غيرلها تماما من شخصيتها
و كاين الوضع العكسي
كم من زوج كان من احسن الناس لكن بمجرد ارتباطه مع امرأة ما تغير للاسوء
الحق يقال الامر نسبي و تجارب الناس تختلف لا يمكن ان نخرج بنتائج مضبوطة
ربي خلق و فرق
شكرا اخي وحيد
على المشاركة القيمة

نسأل الله أن يهدينآ جميعا الى ما يحبّه و يرضاه ..


و عليكم السلام و رحمة الله و بركاته

اليوم وين خرجت كيما مشيت صب شوية و حد 4 ثواني :1: قلت و اخيرا ظهر بعدها اتخفى تماما و اتغلبت اعليه الامطار ،صديقتي قالتلي هذا جابوا غير الريح ماكان والو :)

بالنسبة للسؤال أكيد اخي وحيد كلاهما يصلح الآخر و عيوب ذاك ليست عيوب تلك الا أنه غالبا ما أرى و أسمع أن صلاح المرأة يؤثر في الرجل و قابلية التغيير نحو الأحسن تكون عنده أكثر.

و يبقى الهدف الحقيقي من الزواج هو اعانة كلاهما الآخر على طاعة لله

بالتوفيق ان شاء الله و جزاك الله خيرا.

و ذلك هو أسمى هدف قد يكون بين الزوجين ..
فالاعانة على الطاعة هو أمر مطلوب بينهما ..

بالمناسبة أختي عطر الملكة كان الله في عون لوحة مفاتيحك و كذلك أخي معا الى الله :1:

تحية لكما على السريع :)

و من هو أخوك معآ إلى الله .... :1:

معاً إلى الله
2012-02-07, 14:38
يسعد مساك غاليتي


لهذه الاسباب و من اجلها لو تشوفي لي كلافي الخاسرين عندي تدوخي ههههههههههههههههههههه
لوحة المفاتيح عندي راها تعاني

تعرفين عزيزتي ..
حين يكون مآ خطّته أيدينا فيه فائدة و فيه ما يرضي الله ..
و حين نكون أمآم الله لنحآسب ..
حينهآ فقط سندرك قيمة هذه الحروف التي ندقّهآ بين الفينة و الأخرى ..

فلنحتسب أجر ما نكتبه ..
و لنسأل الله أن يثبّتنآ على القول الحسن ..
و أن يجعل هذه الدقّآت و هذآ التواجد .. خآلصا لوجهه الكريم ..

و أن يحسن خاتمتنآ ..
اللهمّ آمين .. أجمعين ..


جميل جدا حضرة المحامية
الا تعتقدين ان الامر مرتبط بمدى قالبيلة الانسان بالتغيير اي مرتبط اساسا بعقل الانسان
والرجل اكثر قابلية في التغيير لانه يملك عقلا اكثر تفوقا من المراة
والمراة اذا كانت خبيثة فمن الصعب او المستحيل اصلاحها
عموما افهم من كلامك
ان المراة هي االاكثر تاثيرا على الرجل والواقع يثبت ذلك
نسكن في تيبازة .......تحت مستوى البحر ههههههههه
بارك الله فيك اختي

على أيّ أساس يا أخي الكريم تقول أنّ الرجل قابل للتغيير أكثر من المرأة ؟
أهي دراسة علميّة .. أم قانون ثابت ؟؟

أعلم أنّ الله خلق و فرّق ..
و كما كاين هاك كاين هاك ..

كلٌّ حسب الفطرة التي جـُبـِلَ عليها ..

عــنــدمــا نــقــف أمــام عــدســات [الــتــصــويــر]

فــإنّــنــا نــبــدأ فــي تــحــســيــن مــظــهــرنــا

لــتــبــدو الــصّــورة أكــثــر جــمــالا لــنــاظــرهــا

" " فــمــا بــالــكـ

و أنّ "الــلّــه سبحــانه"

دومــا يـــراكـ و يــطّــلــع عــلــى أعــمــالــكـ و أقــوالــكـ و أفــعــالــك

و حــتــى نــوايــاك و ســريــرتــكـ و قــلــبــكـ ؟

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/p480x480/428989_226923814067207_100002487701654_513128_1806 823199_n.jpg

يآآآآ الله ....
بوركتَ أخي الكريم على هذه الكلمات القويّة .. :)

- احـــذر فرقعة الاصابع

- تسبب أضرار بالغة في أربطة ومفاصل الأصابع و الصوت المرتفع لفرقعة الأصابع يكون ناتجاً عن انخفاض حاد في الضغط خلال كبسولة المفصل
تتسبب في تكوين فقاعة من السائل حول المفصل.
- خلل مزمن في المفصل فيجعل الشخص غير قادر على تحريك الاصابع بعد مرور فترة زمنية بسيطة
اذا كان مكثرا من فرقعة الاصابع

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/417968_226922960733959_100002487701654_513124_3522 63689_n.jpg

أنا للأسف أحيانا أكثر من هذه العادة السيّئة ...
هل من حلووووول ... :mad: :sdf:

و الله يا اخي وحيد صحيح قابلية الانسان للتغيير لها دور من حيث الوقت و من حيث الجهد المبذول من اجل التغيير
لكن فكرة ان الرجل يملك عقلا اكثر تفوق من المرأة فلا يوجد اي دليل على ذلك لا شرعا و لا علميا ولا تقلي النساء ناقصات عقل و دين لان الكل فاهم معنى الحديث فلا داعي للدخول في تلك التفاصيل ...............
واقعيا المراة وصل مستوى تفوقها على الرجل لدرجة انها درست مجالات الرجل نفسه لم ينجح فيها و دخلت حتى في اعمال كثير رجال لم يدخلوها يعني القدرات العقلية للانسان لا علاقة لها بذلك
اذا تكلمنا عن القدرات العقلية للمرأة علميا اثبت ان المرأة بامكانها ان تعمل كذا عمل في وقت واحد فقد تجدها تحمل رضيعها و عينها على التلفزيون و ربما فاتحة موضوع تتكلم فيه و مركزة على كل هذه الامور في حين الرجل لا يمكنه التركيز على اكثر من عمل في وقت واحد
نأتي لتأثير المرأة على الرجل واقعيا نعم تأثر تأثير كبير
الرجل بطبعه ضعيف امام المرأة فما بالك لو ان هذ المرأة على قدر من الجمال و الدهاء و حلاوة لسان من المؤكد انه سيصبح خاتم في اصبعها تلقائيا ومن غير ما يشعر انه تغير و انه تحت تأثيرها
كم من عائلة كانت متماسكة و متحابة و بدخول امرأة ما اصبح كل واحد في جهة بل انه كثير منهم دخلوا مع بعض في محاكم بسبب الميراث و المادة و السبب الرئيسي وراء ذلك هو تخطيط النساء
كيدنا عظيم يا اخي فلا تقلل من مستوى تفكير المرأة و لتعلم ان المرأة اذا كان قلبها فارغ من الايمان و خوف الله صدقني هي قادرة على فعل الكثير الكثير لهذا الرسول صلى الله عليه و سلم امر بالارتباط بذات الدين
و اكبر دليل على كلامي قصة السيدة زليخة مع سيدنا يوسف و كيدها و كيد نساء مصر كان من منطلق انهن لم يكن على ايمان ولا على معرفة بالله
لذلك ان غاب الايمان و خوف الله عن المرأة فلا تستغرب و لا تتعجب مما قد يحدث !!!!!!!!!!
اضافة ان تأثر الام عن البنت و تربيتها سيجعل منها نسخة من امها
لذلك الانسان لما يقدم على خطبة امرأة ما يتوجب عليه ايضا ان يتحرى بعض الشيء عن الام
لا ادري ان كنت قد وصلت فكرتي
لكن ثق تماما ان المرأة اقدر على التغيير من الرجل

اللهم لا تجعلنا من الكائدات المكيدآت ..
و اجعلنا من الصالحات المتقيات العفيفات ..

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
صلى الله عليه وسلم

جزيت بالمثل ان شااء الله

امين امين امين
ان شااء الله سأتريث بين كل 2 و3 فوائد :19:
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
وعليكم السلام
وفيك البركه اخي محمد
جزيت بالمثل ان شااء الله
وهاهو ذا الموضوع الذي طلبتــــه :

| مقتطفات | متجدده بإذن الله .. (http://www.djelfa.info/vb/showthread.php?t=805468) ‏(http://www.djelfa.info/vb/images/misc/multipage.gif 1 (http://www.djelfa.info/vb/showthread.php?t=805468)2 (http://www.djelfa.info/vb/showthread.php?t=805468&page=2)3 (http://www.djelfa.info/vb/showthread.php?t=805468&page=3) ... الصفحة الأخيرة (http://www.djelfa.info/vb/showthread.php?t=805468&page=9))
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
هيه كنت مع الثلج هههه..

ان شااء الله

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

مرحبآ أخونآ عقبة ..
ما هذه الغيبة .. :rolleyes:
بصحتك الثلج .. :)
عساك بخير ان شاء الله .. :mh31:

بارك الله فيك أخي عقبة

هذا هو ما كنت أبحث عنه بالذات
جزاك الله خيرا أخي وجعل ما تنشره في ميزان حسناتك
ولعلمك فإني أنشرها عندي ويستفيد منها الكثير
شكرا جزيلا لك أخي العزيز

ثبّت الله أجركما ..
السلام عليكم ورحمة الله وبركاته
ان شاء الله الجميع بخير
فلن احدد اخاف ان انسى واحد منكم يا رواد الدار الداركم

اللهمَ أرزقِنــًــَآ مٱنُــرِيـــدّ ...
ۆآرزقّ قٍــلۆبُنــــــَآ مٱتُــرِيـد ...
ۆآجَعْلنــَآ لـگَ گــمْآ تُــرِيدّ ♥

اللهم آمين يا رب العالمين ..

مرحبآ عزيزتي .. نحن بخير و لله الحمد و الشكر ..
عساكِ بألف ألف ألف خيـــر .. :mh31:

أحلى هدية مني

http://assa97.jeeran.com/azzoz.swf (http://assa97.jeeran.com/azzoz.swf)

و مآ أروع هديّتكِ و ما أروعكِ ..

جزآكِ الله الجنّة ..

جآري النشر .. :19:

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-07, 14:38
سَلآَمُ ـاللهُ عَلَيْكُمْـ أَهْلَ الدَّاآإأرْ ، كَيْفَ الأَحْوآلْ ؟ انْ شَآءَ الله بِخَيْرْ ؟

أَتَيْتُكُمْ بمَوْضُوعْ لَطآلَمآ رَآوَدَنِي فَأحْبَبْتُ طَرْحهُ هُنَآ :rolleyes:

ــــــــــــــــــــــــــــــــــــــــــــــــــ ــــــــــــــــــــــــــــــــــــــــــــــــــ ــــــــــــــــــــــــــــــــــــــــــــــــــ ـ

هَلِْ أَنْتَ[تِ] مِنْ مُحبِّيْ اسْتِقْبَآلْ الضُّيُوفْ ؟ ، بَعِيدًآ عَن الكَرَمِ و الجُودْ فَنَحْنُ نَعْلَمُ و نَعِي جَيِّدًآ بِأَنّ الجَزآئريين يَغْلَبُ عَلَيهم طَآبع الجُودِ و الكَرَمْ ، لَكِنْ ، هَلْ لَكَـ[ـي] وَ أَنْ انْزَعَجْتَـ[يِ] مِنْ قُدُومِ الضُّيُوفْ خآصَّةً الأَطْفَآلْ :D ، وَ فِي رَأيِكَـ[كِ] ,, مآهوَّ الوَقْتْ المُنآسِبْ للزِّيَّآرَة ؟ فَهُنآلِكَـ مَن يُفضِّلْ المَسَآءْ و مِنْهُمْ مَنْ يُفضِّلْ اللَّيْلْ و مَِنهُم و منهم ,,, إِلَخْ

ــــــــــــــــــــــــــــــــــــــــــــــــــ ــــــــــــــــــــــــــــــــــــــــــــــــــ ـــــــــــــــــــــــــــــــــــــــــ

فِي سيّآق َذآ الحَدِيثْ ، أَحْضَرْتُ لَكُنََّ سيِّدآتِي

كَيْفَ يَكُونَ مَنزْلكِ جَاهِزًا لإِسْتِقْبَالِ الضُّيوفِ فِي 30 دَقِيقَة

إليك بعض الملحوظات التي قد تساعدك في الإسراع بتجهيز المنزل في أسرع وقت:

1 - تفقدي هندامك دَائما، إذ أول أمر يلحظه الضيوف هو شكلك وليس غرفه جلوسك.

2 - حاولي إغلاق الأبواب، حيث أن إغلاق أبواب الغرف التي لن تستعمليها أثناء الزيارة سوف يوفر عليك الوقت الذي ستقضينه في ترتيبها.
3- استخدمي أحد الأكياس الكبيرة لجمع كل ما هو غير ضروري في الغرفة التي ستقومين باستقبال الضيوف فيها، لكن تأكدي من وضع الكيس في مكان لا يراه الضيوف.

4 - حاولي مسح الغبار والأتربة الموجودة في الغرفة التي سوف تقومين فيها باستقبال الضيوف.

5 - قومي بترتيب الأثاث وإعادة ترتيب الوسائد الموجودة على المقاعد.

6- تأكدي من نظافة الحمام، قومي بالتأكد من نظافة المغسلة و من وجود صابون و قومي بوضع مناشف نظيفة.

7- إذا كان لديك المزيد من الوقت قومي بكنس الغرفة التي ستقضين فيها معظم الوقت مع ضيوفك.

8- قومي بالتأكد من نظافة المطبخ لأن احتمال أن يتبعك الضيوف إلى المطبخ كبير.

9- قومي برش معطر الجو في أنحاء البيت لان ذلك يعطي شعوراً بالنظافة في كل أنحاء المنزل

معاً إلى الله
2012-02-07, 14:44
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

بسم الله الرحمن الرحيم

و الصـلآة و السـلآم على أشـرف المرسليـن

السلام عليكم ورحمة الله تعالــى وبركاته :

لقد جمعت لكم فــيـ هذا الموضوع اكبر عدد ممكن من الصور

الرمزية الدعوية + التواقيع الدعوية

[[ اكثر من 110 صورة دعوية ]]
















































































































|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

و عليكم السلام و رحمة الله و بركاته ..

بارك الله فيك و جزاك الله خيرآ أخي الكريم عقبة ..
رائعة جدّآ .. جعلها الله في ميزان حسناتك ..

قد أختار واحدة لأغيّر صورتي الرمزيّة .. :)

سآجدْ للهْ
2012-02-07, 14:50
و عليكم السلام و رحمة الله و بركاته ..

بارك الله فيك و جزاك الله خيرآ أخي الكريم عقبة ..
رائعة جدّآ .. جعلها الله في ميزان حسناتك ..

قد أختار واحدة لأغيّر صورتي الرمزيّة .. :)

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
وفيك البركه وجزيت بالمثل ان شااء الله
رفع قدرك الباري

موفقة في الاختيار ان شاااء الله

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

معاً إلى الله
2012-02-07, 14:58
سَلآَمُ ـاللهُ عَلَيْكُمْـ أَهْلَ الدَّاآإأرْ ، كَيْفَ الأَحْوآلْ ؟ انْ شَآءَ الله بِخَيْرْ ؟

أَتَيْتُكُمْ بمَوْضُوعْ لَطآلَمآ رَآوَدَنِي فَأحْبَبْتُ طَرْحهُ هُنَآ :rolleyes:

ــــــــــــــــــــــــــــــــــــــــــــــــــ ــــــــــــــــــــــــــــــــــــــــــــــــــ ــــــــــــــــــــــــــــــــــــــــــــــــــ ـ

هَلِْ أَنْتَ[تِ] مِنْ مُحبِّيْ اسْتِقْبَآلْ الضُّيُوفْ ؟ ، بَعِيدًآ عَن الكَرَمِ و الجُودْ فَنَحْنُ نَعْلَمُ و نَعِي جَيِّدًآ بِأَنّ الجَزآئريين يَغْلَبُ عَلَيهم طَآبع الجُودِ و الكَرَمْ ، لَكِنْ ، هَلْ لَكَـ[ـي] وَ أَنْ انْزَعَجْتَـ[يِ] مِنْ قُدُومِ الضُّيُوفْ خآصَّةً الأَطْفَآلْ :D ، وَ فِي رَأيِكَـ[كِ] ,, مآهوَّ الوَقْتْ المُنآسِبْ للزِّيَّآرَة ؟ فَهُنآلِكَـ مَن يُفضِّلْ المَسَآءْ و مِنْهُمْ مَنْ يُفضِّلْ اللَّيْلْ و مَِنهُم و منهم ,,, إِلَخْ

ــــــــــــــــــــــــــــــــــــــــــــــــــ ــــــــــــــــــــــــــــــــــــــــــــــــــ ـــــــــــــــــــــــــــــــــــــــــ

فِي سيّآق َذآ الحَدِيثْ ، أَحْضَرْتُ لَكُنََّ سيِّدآتِي

كَيْفَ يَكُونَ مَنزْلكِ جَاهِزًا لإِسْتِقْبَالِ الضُّيوفِ فِي 30 دَقِيقَة

إليك بعض الملحوظات التي قد تساعدك في الإسراع بتجهيز المنزل في أسرع وقت:

1 - تفقدي هندامك دَائما، إذ أول أمر يلحظه الضيوف هو شكلك وليس غرفه جلوسك.

2 - حاولي إغلاق الأبواب، حيث أن إغلاق أبواب الغرف التي لن تستعمليها أثناء الزيارة سوف يوفر عليك الوقت الذي ستقضينه في ترتيبها.

3- استخدمي أحد الأكياس الكبيرة لجمع كل ما هو غير ضروري في الغرفة التي ستقومين باستقبال الضيوف فيها، لكن تأكدي من وضع الكيس في مكان لا يراه الضيوف.

4 - حاولي مسح الغبار والأتربة الموجودة في الغرفة التي سوف تقومين فيها باستقبال الضيوف.

5 - قومي بترتيب الأثاث وإعادة ترتيب الوسائد الموجودة على المقاعد.

6- تأكدي من نظافة الحمام، قومي بالتأكد من نظافة المغسلة و من وجود صابون و قومي بوضع مناشف نظيفة.

7- إذا كان لديك المزيد من الوقت قومي بكنس الغرفة التي ستقضين فيها معظم الوقت مع ضيوفك.

8- قومي بالتأكد من نظافة المطبخ لأن احتمال أن يتبعك الضيوف إلى المطبخ كبير.

9- قومي برش معطر الجو في أنحاء البيت لان ذلك يعطي شعوراً بالنظافة في كل أنحاء المنزل

و عليكم السلام و رحمة الله و بركآته ..

أهلآ و سهلا بالعزيزة المبدعة في خطّهآ .. :19:

موضوع رآق و مهمّ للغاية ..
فكثير ما يصادفنا و كثير ما يحدث أن يأتينا ضيف و نحن غير مستعدّين .. :rolleyes:

فيمآ يخصّ سؤالك الأوّل ..
سأجيب و أقول أنني نعم من محبّآت استقبال الضيوف .. بشرط .. http://www.djelfa.info/vb/images/icons/icon10.gif
ان يُعلمني الضّيف بقدومه قبل فترة .. :)

أمآ فيما يخصّ الأطفال المصاحبين للضيوف ..
فلا بأس من احضآرهم .. [ ماراناش في العرس نقولو : pas d'enfants ] :1:
لكنني أعتبر نفسي من النوع القلق نوعا ما حين يكون الطفل يبوجي فوق اللآزم .. http://www.djelfa.info/vb/images/icons/icon10.gif
فبيني و بينك لا أجد حرجا في نهيه عن فعل ما لا يجوز ..
ان كانت الوالدة من المقربات لي ..

أمّآ ان كان الأمر مختلف .. حيث تكون الوالدة أول مرة تزورني و لا أعرفها جيّدآ ..
فقد أكتم الغيظ في نفسي .. و أقول: خليه معليش ..
و أنا قلبي في الداخل راه ياكل .. :1::1:


و الله بيني و بينك يا أختي الكريمة ..
كاين بعض الناس يشوفوا ولادهم يديروا في المنكر و لا يلومونهم .. :mad:
يطلع بالصباط فوق الفوتاي .. أو يحمل فازة .. أو يكرّط في الطابلة ..

تلقايهم عادي يضّحكوا و لا على بالهم شيء .. :mad::mad::mad:

أنا نقولك الصح .. مااا نحملش .. و لو فعل ذلك أحد من أولادي ..
تجديني أجري مور هذا و الآخر .. و لا استمتع بالحديث ..
و مام يقولولي خليهم معليش .. أرفض أن أتركهم ..

لأني كما ما نحبش الخسارة ليا .. ما نحبهاش لغيري ..

و تبقى هذه الأمور فطرة يتربى عليها الانسان منذ الصّغر ..


نصائح قيّمة نقلتيها لنا .. بارك الله فيك ..

تفكّرت وآحد اللقطة في توم و جيري .. كي بدى يكنس و يدخل الزبالة تحت الزربية :1::1:

كاين واحد المثل يقول :
[ نخملوا غير وين يشوف أحمد ] .. http://www.djelfa.info/vb/images/icons/icon10.gif

لا تسأليني من أحمد .. :1::1: .. فلا أعرفه ..

لي نقولو المثل يقولي : شكون أحمد ... http://www.djelfa.info/vb/images/icons/mh01.gif

معاً إلى الله
2012-02-07, 15:02
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
وفيك البركه وجزيت بالمثل ان شااء الله
رفع قدرك الباري

موفقة في الاختيار ان شاااء الله

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

اللهم آمين يا رب العالمين ..

جاري الاختيار في الحيـــــن .. :19:

جعلها الله في ميزان حسناتك

معاً إلى الله
2012-02-07, 15:13
ألوان ليست في مكانها الصحيح

أعجبني العنوان فنقلت لكم الصــــــور...
ما الذي شدّني إلى عنوان الموضوع...؟؟؟ّ!!!
تخيّلت استغرابنا من وجود هذه الألوان في مكان ليس بمكانها...
بمعنى أن ما تعارفنا عليه ليس هو ما نراه...
هل خطر ببالنا ذات مرة أن نرى تصرفاتنا غير السليمة التي نقوم بها عوضاً عن التصرفات الصحيحة ووضعناها تحت المجهر...
هل نمنا قريري الأعين بعد مقابلة الإحسان بالإساءة...
هل اطمأن بالنا اثر إفشاء سرّ أؤتمنا عليه...
هل وضعنا أنفسنا مكان مَنْ اغتبناهم...
هل فرحنا بشهادة الزور اكراماً لأحدهم...
هل انتبهنا إلى وقوفنا بجانب الظالم لأنه ذو منصب ومال...

ترى هل خالجتنا هذه الأسئلة يوماً ما...؟؟؟!!!
أم أن رحى الحياة قد طحنت حتى لحظات مراجعة أنفسنا...

لست فيلسوفة أبداً ولن أكون...
لكنه خاطر طرأ على بالي حينما أعجبني عنوان الموضوع...

والآن مع الألوان التي ليست في مكانها...

















سآجدْ للهْ
2012-02-07, 15:17
التواقيع الدعوية :
[[ اكثر من 170 توقيع دعوي *** ]]



*** http://www.aljnh.com/islamec/images/signatures/forum165.gif






*** http://www.aljnh.com/islamec/images/signatures/forum159.gif

*** http://www.aljnh.com/islamec/images/signatures/forum158.gif
*** http://www.aljnh.com/islamec/images/signatures/forum157.gif


*** http://www.aljnh.com/islamec/images/signatures/forum155.gif




*** http://www.aljnh.com/islamec/images/signatures/forum151.gif




*** http://www.aljnh.com/islamec/images/signatures/forum147.gif


*** http://www.aljnh.com/islamec/images/signatures/forum145.gif

*** http://www.aljnh.com/islamec/images/signatures/forum144.gif




*** http://www.aljnh.com/islamec/images/signatures/forum140.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum139.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum138.jpg
*** http://www.aljnh.com/islamec/images/signatures/forum137.jpg


*** http://www.aljnh.com/islamec/images/signatures/forum135.gif


*** http://www.aljnh.com/islamec/images/signatures/forum133.gif


*** http://www.aljnh.com/islamec/images/signatures/forum131.gif



*** http://www.aljnh.com/islamec/images/signatures/forum128.gif
*** http://www.aljnh.com/islamec/images/signatures/forum127.gif




*** http://www.aljnh.com/islamec/images/signatures/forum123.gif






*** http://www.aljnh.com/islamec/images/signatures/forum117.gif

*** http://www.aljnh.com/islamec/images/signatures/forum116.gif



*** http://www.aljnh.com/islamec/images/signatures/forum113.gif

*** http://www.aljnh.com/islamec/images/signatures/forum112.gif

*** http://www.aljnh.com/islamec/images/signatures/forum111.gif

*** http://www.aljnh.com/islamec/images/signatures/forum110.gif


*** http://www.aljnh.com/islamec/images/signatures/forum108.gif



****** http://www.aljnh.com/islamec/images/signatures/forum106.gif

*** http://www.aljnh.com/islamec/images/signatures/forum105.gif

*** http://www.aljnh.com/islamec/images/signatures/forum104.gif


*** http://www.aljnh.com/islamec/images/signatures/forum102.gif


*** http://www.aljnh.com/islamec/images/signatures/forum100.gif


*** http://www.aljnh.com/islamec/images/signatures/forum98.jpg




*** http://www.aljnh.com/islamec/images/signatures/forum94.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum93.gif




*** http://www.aljnh.com/islamec/images/signatures/forum89.gif

*** http://www.aljnh.com/islamec/images/signatures/forum87.gif


*** http://www.aljnh.com/islamec/images/signatures/forum85.gif


*** http://www.aljnh.com/islamec/images/signatures/forum83.gif




*** http://www.aljnh.com/islamec/images/signatures/forum79.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum78.gif
*** http://www.aljnh.com/islamec/images/signatures/forum77.gif

*** http://www.aljnh.com/islamec/images/signatures/forum76.gif


*** http://www.aljnh.com/islamec/images/signatures/forum74.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum73.jpg


*** http://www.aljnh.com/islamec/images/signatures/forum71.jpg



*** http://www.aljnh.com/islamec/images/signatures/forum68.gif


*** http://www.aljnh.com/islamec/images/signatures/forum66.gif

*** http://www.aljnh.com/islamec/images/signatures/forum65.gif

*** http://www.aljnh.com/islamec/images/signatures/forum64.gif

*** http://www.aljnh.com/islamec/images/signatures/forum63.gif









****** http://www.aljnh.com/islamec/images/signatures/forum54.gif


*** http://www.aljnh.com/islamec/images/signatures/forum52.gif

*** http://www.aljnh.com/islamec/images/signatures/forum51.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum50.gif

*** http://www.aljnh.com/islamec/images/signatures/forum49.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum48.gif

*** http://www.aljnh.com/islamec/images/signatures/forum47.gif

*** http://www.aljnh.com/islamec/images/signatures/forum46.gif

*** http://www.aljnh.com/islamec/images/signatures/forum45.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum44.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum43.jpg



*** http://www.aljnh.com/islamec/images/signatures/forum40.gif




*** http://www.aljnh.com/islamec/images/signatures/forum36.gif

*** http://www.aljnh.com/islamec/images/signatures/forum35.gif



*** http://www.aljnh.com/islamec/images/signatures/forum32.gif



*** http://www.aljnh.com/islamec/images/signatures/forum29.gif


*** http://www.aljnh.com/islamec/images/signatures/forum27.gif

*** http://www.aljnh.com/islamec/images/signatures/forum26.gif

*** http://www.aljnh.com/islamec/images/signatures/forum25.gif

*** http://www.aljnh.com/islamec/images/signatures/forum24.gif

*** http://www.aljnh.com/islamec/images/signatures/forum23.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum22.gif


*** http://www.aljnh.com/islamec/images/signatures/forum20.gif

*** http://www.aljnh.com/islamec/images/signatures/forum19.gif

*** http://www.aljnh.com/islamec/images/signatures/forum18.gif

*** http://www.aljnh.com/islamec/images/signatures/forum17.gif

*** http://www.aljnh.com/islamec/images/signatures/forum16.gif

*** http://www.aljnh.com/islamec/images/signatures/forum15.gif

*** http://www.aljnh.com/islamec/images/signatures/forum14.gif

*** http://www.aljnh.com/islamec/images/signatures/forum13.gif


*** http://www.aljnh.com/islamec/images/signatures/forum11.gif

*** http://www.aljnh.com/islamec/images/signatures/forum10.jpg

*** http://www.aljnh.com/islamec/images/signatures/forum9.gif


*** http://www.aljnh.com/islamec/images/signatures/forum7.gif

*** http://www.aljnh.com/islamec/images/signatures/forum6.gif


*** http://www.aljnh.com/islamec/images/signatures/forum4.gif

*** http://www.aljnh.com/islamec/images/signatures/forum3.gif

*** http://www.aljnh.com/islamec/images/signatures/forum2.gif



الموضوع الأصلــي :

تفـــضلوا◄ صور رمزية دعوية + توآقيع جـــآهزة (http://www.djelfa.info/vb/showthread.php?t=860583)

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

راجي الصّمدِ
2012-02-07, 16:27
السّلام عليكم ورحمة الله وبركاته
جزيتم خيرا جميعا أيّها الجمع الطيب المبارك ..
ونعتذر عن قلّة مشاركة إخواننا وأخواتنا ...

قال الشَّيخ البشير الإبراهيمي رحمه الله: (http://www.rayatalislah.com/faidah.php?id=9)
«والشَّباب المحمَّدي أحقُّ شباب الأمم بالسَّبْقِ إلى الحياة، والأخذ بأسباب القوَّة؛ لأنَّ لهم من دينهم حافزًا إلى ذلك، ولهم في دينهم على كلِّ مَكْرُمَةٍ دليلٌ، ولهم في تاريخهم على كلِّ دعوى في الفخار شاهدٌ.
أعيذُ الشَّباب المحمَّدي أن يُشْغِلَ وقتَه في تِعْدَاد ما اقترفه آباؤُه من سيِّئات أو في الافتخار بما عملوه من حسنات، بل يبني فوق ما بَنَى المحسنون ولْيَتَّقِ عثرات المسيئين.
وأُعيذه أن ينام في الزَّمان اليقظان، أو يَهْزَلَ والدَّهر جادٌّ، أو يرضى بالدُّون من منازل الحياة.

يا شباب الإسلام! وصيَّتي إليكم أن تتَّصلوا بالله تديُّنًا، وبنبيِّكُمْ اتِّباعًا، وبالإسلام عملًا، وبتاريخ أجدادكم اطِّلاعًا، وبآداب دينكم تخلُّقًا، وبآداب لغتكم استعمالًا، وبإخوانكم في الإسلام ولِدَاتِكم في الشَّبيبة اعتناءً واهتمامًا، فإنْ فعلتم حُزْتُمْ منَ الحياة الحظَّ الجليلَ، ومن ثواب الله الأجرَ الجزيلَ، وفاءت عليكم الدُّنيا بظلِّها الظَّليلِ».
[مكة المكرمة: في 1 صفر الخير 1372هـ]

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-07, 16:28
و عليكم السلام و رحمة الله و بركآته ..

أهلآ و سهلا بالعزيزة المبدعة في خطّهآ .. :19:

موضوع رآق و مهمّ للغاية ..
فكثير ما يصادفنا و كثير ما يحدث أن يأتينا ضيف و نحن غير مستعدّين .. :rolleyes:

فيمآ يخصّ سؤالك الأوّل ..
سأجيب و أقول أنني نعم من محبّآت استقبال الضيوف .. بشرط .. http://www.djelfa.info/vb/images/icons/icon10.gif
ان يُعلمني الضّيف بقدومه قبل فترة .. :)

أمآ فيما يخصّ الأطفال المصاحبين للضيوف ..
فلا بأس من احضآرهم .. [ ماراناش في العرس نقولو : pas d'enfants ] :1:
لكنني أعتبر نفسي من النوع القلق نوعا ما حين يكون الطفل يبوجي فوق اللآزم .. http://www.djelfa.info/vb/images/icons/icon10.gif
فبيني و بينك لا أجد حرجا في نهيه عن فعل ما لا يجوز ..
ان كانت الوالدة من المقربات لي ..

أمّآ ان كان الأمر مختلف .. حيث تكون الوالدة أول مرة تزورني و لا أعرفها جيّدآ ..
فقد أكتم الغيظ في نفسي .. و أقول: خليه معليش ..
و أنا قلبي في الداخل راه ياكل .. :1::1:


و الله بيني و بينك يا أختي الكريمة ..
كاين بعض الناس يشوفوا ولادهم يديروا في المنكر و لا يلومونهم .. :mad:
يطلع بالصباط فوق الفوتاي .. أو يحمل فازة .. أو يكرّط في الطابلة ..

تلقايهم عادي يضّحكوا و لا على بالهم شيء .. :mad::mad::mad:

أنا نقولك الصح .. مااا نحملش .. و لو فعل ذلك أحد من أولادي ..
تجديني أجري مور هذا و الآخر .. و لا استمتع بالحديث ..
و مام يقولولي خليهم معليش .. أرفض أن أتركهم ..

لأني كما ما نحبش الخسارة ليا .. ما نحبهاش لغيري ..

و تبقى هذه الأمور فطرة يتربى عليها الانسان منذ الصّغر ..


نصائح قيّمة نقلتيها لنا .. بارك الله فيك ..

تفكّرت وآحد اللقطة في توم و جيري .. كي بدى يكنس و يدخل الزبالة تحت الزربية :1::1:

كاين واحد المثل يقول :
[ نخملوا غير وين يشوف أحمد ] .. http://www.djelfa.info/vb/images/icons/icon10.gif

لا تسأليني من أحمد .. :1::1: .. فلا أعرفه ..

لي نقولو المثل يقولي : شكون أحمد ... http://www.djelfa.info/vb/images/icons/mh01.gif

مَشْكُورَة جِدًّآ علَى الرَّأيْ الصَّرِيحْ

صَرَآحَة ! أَنآ الوَحِيدْة فِي البَيْتْ التِي أكْرَه الضُّيُوف و خَآصَّةً الصِّغآرْ :cool:

وَسبب هَذآ الكُرْه ~ مَوْقِفْ حَدَثَ لِي فِي بَيْتِ جدِّي ، حَيْثُ أُقِيمَت [عَرْضَة بين الأَقَآرِبْ] فَحَضَرَتْ 4 أَخوآتْ صَغِيرَآتْ [ربي يَحفَظهم عَلى كُلِّ حآلْ] الفَرْق في عُمْرْ كُلّ وآحِدَة عَآمَيْنْ ، شَبْعُونآ المْرَآرْ :mad: ، كُنَّ مَعْرُوفآتْ بشَطآرتهنَّ حَتَّى أَنَّهنّ يَتَدخَّلْنَ فِي عَمَلِي الذِي أَقُومُ بِهِ :mad::mad:، لَيسَ هَذآ فَقَطْ ! َبَلْ أَنَّهُن اشتَرَطُن عَلَيْنآ أَن يَكُونَ ذَآكـ الطَّبق فِي وجبة الغَدَآء فانْ لَم يُحضَّرْ لَن يَتَنآولن الغَدَآءْ :mad:

كَآنَ يْومًآ مُتْعِبًآ جِدًّآ جِدًّآ

2012-02-07, 18:11
السلام عليكم

خليت البارحة صورة لأكلة قسنطينية و ربما هناك من أراد أن يعرف إسمها

http://im9.gulfup.com/2012-02-07/1328566335201.jpg (http://www.gulfup.com/show/X39qwmwtcwmub)

هي المشلوش

إن شاء الله تجيكم الفرصة و تاكلوها
لذيذة جدا :rolleyes::rolleyes::rolleyes:

آلاء الرحـــــــمن
2012-02-07, 18:34

كيف حالكم احبائي ارى اليوم ان عدد المشاركات قليل ترى ما السبب؟؟؟
اليوم كنا في توديع جدتي حفظها الله الى البقاع المقدسة لاداء العمرة لهذا لم ازركم .......
لقد طلبت منها ان تدعوا لاحبائي في منتدى الجلفة وهي في الحرم ...
ادعوا الله ان تعود لنا سالمة غانمة ....
لي عودة بعد تكملت قراءة المشاركات...

آلاء الرحـــــــمن
2012-02-07, 18:36
السلام عليكم

خليت البارحة صورة لأكلة قسنطينية و ربما هناك من أراد أن يعرف إسمها

http://im9.gulfup.com/2012-02-07/1328566335201.jpg (http://www.gulfup.com/show/x39qwmwtcwmub)

هي المشلوش

إن شاء الله تجيكم الفرصة و تاكلوها
لذيذة جدا :rolleyes::rolleyes::rolleyes:
اذا اسمها المشلوش
اخي لو تفضلت واعطيتنا الوصفة نكون جد شاكرين صراحة اعجبني شكلها جدا

2012-02-07, 18:51
اذا اسمها المشلوش
اخي لو تفضلت واعطيتنا الوصفة نكون جد شاكرين صراحة اعجبني شكلها جدا

صراحة لا أعرف طريقة تحضيرها. أنا نعرف ناكل برك

ما أعرفه أنها مثل القطايف لكن أعرض يوضع عليها العسل الحر و الجوز مرحي و تأكل مع اللبن :1::1::1:

خخخخخخخخخ هذا واش نعرف

2012-02-07, 18:53
درت بحث في غوغل هاو ليك واش لقيت


2012-02-07, 19:05

محمد جديدي التبسي
2012-02-07, 19:09
رســـــــالــــــــــة أخجلتني من نفسي؟؟؟؟؟؟؟؟؟؟؟؟؟؟

هل تساءلت يوما ماذا كان سيحصل لو تعاملنا مع القرآن مثل ما نتعامل مع هواتفنا النقالة؟؟؟؟؟؟؟؟؟؟؟؟

ماذا لو حملناه معنا أينما نذهب.... فــي حقائبنا وجيوبنا؟؟

ماذا لو قلبنا في صفحاته عدة مرات في اليوم؟؟

ماذا لو عدنا لإحضاره في حال نسيناه؟؟

ماذا لو عاملناه كما لو أننا لا نستطيع العيش من دونه؟؟

ماذا لو أعطيناه لأطفالنا كهدية؟؟

ماذا لو استخدمناه عند السفر؟؟

ماذا لو لجأنا إليه عند الحالات الطارئة؟؟

هذا أمر يجعلك تتسائل "أين هو مصحفــــــي!!؟؟"

وأيضا على عكس هاتفك لا داعي لأن تخاف على قرآنك من الانقطاع

توقف للحظة وفكر ما هي أولوياتك؟؟

وافعل ما ترى إن الله يريد منك فعله

إذا كنت من الـ 7 % الذين سيدافعون عنه... قم بإعادة إرسال الرسالة لأكبر عدد ممكن.

معاً إلى الله
2012-02-07, 19:31
السّلام عليكم ورحمة الله وبركاته
جزيتم خيرا جميعا أيّها الجمع الطيب المبارك ..
ونعتذر عن قلّة مشاركة إخواننا وأخواتنا ...

قال الشَّيخ البشير الإبراهيمي رحمه الله: (http://www.rayatalislah.com/faidah.php?id=9)

«والشَّباب المحمَّدي أحقُّ شباب الأمم بالسَّبْقِ إلى الحياة، والأخذ بأسباب القوَّة؛ لأنَّ لهم من دينهم حافزًا إلى ذلك، ولهم في دينهم على كلِّ مَكْرُمَةٍ دليلٌ، ولهم في تاريخهم على كلِّ دعوى في الفخار شاهدٌ.

أعيذُ الشَّباب المحمَّدي أن يُشْغِلَ وقتَه في تِعْدَاد ما اقترفه آباؤُه من سيِّئات أو في الافتخار بما عملوه من حسنات، بل يبني فوق ما بَنَى المحسنون ولْيَتَّقِ عثرات المسيئين.
وأُعيذه أن ينام في الزَّمان اليقظان، أو يَهْزَلَ والدَّهر جادٌّ، أو يرضى بالدُّون من منازل الحياة.

يا شباب الإسلام! وصيَّتي إليكم أن تتَّصلوا بالله تديُّنًا، وبنبيِّكُمْ اتِّباعًا، وبالإسلام عملًا، وبتاريخ أجدادكم اطِّلاعًا، وبآداب دينكم تخلُّقًا، وبآداب لغتكم استعمالًا، وبإخوانكم في الإسلام ولِدَاتِكم في الشَّبيبة اعتناءً واهتمامًا، فإنْ فعلتم حُزْتُمْ منَ الحياة الحظَّ الجليلَ، ومن ثواب الله الأجرَ الجزيلَ، وفاءت عليكم الدُّنيا بظلِّها الظَّليلِ».

[مكة المكرمة: في 1 صفر الخير 1372هـ]

مَشْكُورَة جِدًّآ علَى الرَّأيْ الصَّرِيحْ

صَرَآحَة ! أَنآ الوَحِيدْة فِي البَيْتْ التِي أكْرَه الضُّيُوف و خَآصَّةً الصِّغآرْ :cool:

وَسبب هَذآ الكُرْه ~ مَوْقِفْ حَدَثَ لِي فِي بَيْتِ جدِّي ، حَيْثُ أُقِيمَت [عَرْضَة بين الأَقَآرِبْ] فَحَضَرَتْ 4 أَخوآتْ صَغِيرَآتْ [ربي يَحفَظهم عَلى كُلِّ حآلْ] الفَرْق في عُمْرْ كُلّ وآحِدَة عَآمَيْنْ ، شَبْعُونآ المْرَآرْ :mad: ، كُنَّ مَعْرُوفآتْ بشَطآرتهنَّ حَتَّى أَنَّهنّ يَتَدخَّلْنَ فِي عَمَلِي الذِي أَقُومُ بِهِ :mad::mad:، لَيسَ هَذآ فَقَطْ ! َبَلْ أَنَّهُن اشتَرَطُن عَلَيْنآ أَن يَكُونَ ذَآكـ الطَّبق فِي وجبة الغَدَآء فانْ لَم يُحضَّرْ لَن يَتَنآولن الغَدَآءْ :mad:

كَآنَ يْومًآ مُتْعِبًآ جِدًّآ جِدًّآ

السلام عليكم

خليت البارحة صورة لأكلة قسنطينية و ربما هناك من أراد أن يعرف إسمها

http://im9.gulfup.com/2012-02-07/1328566335201.jpg (http://www.gulfup.com/show/x39qwmwtcwmub)

هي المشلوش

إن شاء الله تجيكم الفرصة و تاكلوها
لذيذة جدا :rolleyes::rolleyes::rolleyes:


كيف حالكم احبائي ارى اليوم ان عدد المشاركات قليل ترى ما السبب؟؟؟
اليوم كنا في توديع جدتي حفظها الله الى البقاع المقدسة لاداء العمرة لهذا لم ازركم .......
لقد طلبت منها ان تدعوا لاحبائي في منتدى الجلفة وهي في الحرم ...
ادعوا الله ان تعود لنا سالمة غانمة ....
لي عودة بعد تكملت قراءة المشاركات...

اذا اسمها المشلوش
اخي لو تفضلت واعطيتنا الوصفة نكون جد شاكرين صراحة اعجبني شكلها جدا

صراحة لا أعرف طريقة تحضيرها. أنا نعرف ناكل برك

ما أعرفه أنها مثل القطايف لكن أعرض يوضع عليها العسل الحر و الجوز مرحي و تأكل مع اللبن :1::1::1:

خخخخخخخخخ هذا واش نعرف

درت بحث في غوغل هاو ليك واش لقيت



رســـــــالــــــــــة أخجلتني من نفسي؟؟؟؟؟؟؟؟؟؟؟؟؟؟

هل تساءلت يوما ماذا كان سيحصل لو تعاملنا مع القرآن مثل ما نتعامل مع هواتفنا النقالة؟؟؟؟؟؟؟؟؟؟؟؟

ماذا لو حملناه معنا أينما نذهب.... فــي حقائبنا وجيوبنا؟؟

ماذا لو قلبنا في صفحاته عدة مرات في اليوم؟؟

ماذا لو عدنا لإحضاره في حال نسيناه؟؟

ماذا لو عاملناه كما لو أننا لا نستطيع العيش من دونه؟؟

ماذا لو أعطيناه لأطفالنا كهدية؟؟

ماذا لو استخدمناه عند السفر؟؟

ماذا لو لجأنا إليه عند الحالات الطارئة؟؟

هذا أمر يجعلك تتسائل "أين هو مصحفــــــي!!؟؟"

وأيضا على عكس هاتفك لا داعي لأن تخاف على قرآنك من الانقطاع

توقف للحظة وفكر ما هي أولوياتك؟؟

وافعل ما ترى إن الله يريد منك فعله

إذا كنت من الـ 7 % الذين سيدافعون عنه... قم بإعادة إرسال الرسالة لأكبر عدد ممكن.

بارك الله فيكم جميعآ و جزى الله كلّ من التحق بنا في هذه الأمسية .. مرحبآ بالجميع ..

لا أدري ان كان يحصل معكم نفس المشكل الذي يحصل معي ؟؟..
فأنا أعاني من ثقل صفحات الموضوع ..
لا أدري لما يرجع هذآ .. ربّمآ لكثرة الصور الموجودة فيه أم ماذآ ؟

لذلك أعتذر عن أيّ تأخّر حصل منّي في الردّ ..

الله المستعان ..
ان شاء الله يُحلّ الأمر .. !!

نسائم الهدى
2012-02-07, 19:37
رسالة لأسرة الدار داركم الطيبين
هل لكم إخوتي أن تدخلوا لهذا الرابط؟؟؟؟؟
وأجركم على الله

معاً إلى الله
2012-02-07, 19:37
▔▏ ▂┗┓▂▕▔┛▂┏ ▂▕▔
... .▕▕-▏▕-▏▏'┏▏▕-▏
الحمد لله ♥ الذي وهبنا بيوتاً نأوي اليها في هذا البرد بينما الملايين دون ملجأ
╯▅╰╱▔▔▔▔▔▔▔╲╯╯ ▕▕╱╱╱╱╱╱╱╱╱╲╲╭╭ ▕▕╱╱╱╱╱╱╱╱┛▂╲╲╭ ╱▂▂▂▂▂▂╱╱┏▕╋▏╲╲ ▔▏ ▂┗┓▂▕▔┛▂┏ ▕▕ ▏▕ ▂▕▔.-▏▏'┏▏▕.-

آلاء الرحـــــــمن
2012-02-07, 21:02
إبريق تسخين الماء: أباريق تسخين الماء العادية أو الكهربائية تتعرض لتكون طبقة من الترسبات والتكلس ومن الممكن التخلص من هذه الترسبات بسهولة بالطريقة التالية : - توضع كمية قليلة من الخل في الإبريق ويسخن قليلاً ويخض الإبريق جيداً ويترك بعض الوقت ثم يغسل.

- إذا لم تنجح هذه الطريقة وكانت الترسبات سميكة يمكن أن يوضع في
الإبريق كمية من الماء والخل "بنسب متساوية" ويسخن الإبريق حتى يغلي
لمدة قصيرة "حوالي 5 دقائق" ثم يترك حتى اليوم التالي فيعمل الخل على
تحليل الترسبات.

لوح شوي اللحوم :

- لتفادي التصاق الطعام على اللوح يدهن الشبك ببعض الزيت قبل القيام
بعملية الشوي.
- لتنظيف اللوح المتسخ يرش وهو ساخن بصابون الغسيل أو الصابون
المستعمل في الجلاية ثم يغطى بمحارم ورقية رطبة ويترك لفترة من الزمن
حتى تتحلل الأوساخ والدهون وتحتاج العملية للقليل من الفرك ويفضل
استعمال فرشاة معدنية لفركه إذا كان شديد الاتساخ.

الخلاط الكهربائي :

- لتنظيف الخلاط الكهربائي بسرعة وسهولة يملأ نصفه بماء دافئ ويضاف إليه
القليل من منظف الجلي. ويمكن إضافة القليل من الخل إذا كان الخلاط قد
استعمل لخلط مادة تحتوي على الدهون ثم يغطى الخلاط ويشغل لبضع ثواني
وبعد ذلك ينظف بالإسفنجة ويشطف بالماء.

الخفاقة الكهربائية :

- يفضل نقع اللولب المعدنية فور الانتهاء من استخدامها في ماء بارد ثم تغسل.
- تنظف الخفاقة بإسفنجة مرطبة بالماء وبيكربونات الصودا وتجفف ويمكن
استعمال فرشاة أسنان قديمة لتنظيف الحواف والزوايا الصغيرة لإزالة بقايا
الطعام المخفوق.

ألواح التقطيع :

- للتخلص من رائحة البصل والثوم والسمك وغيرها عن اللوح يفرك بنصف
ليمونة أو يوضع عليه طبقة من معجون معد من الماء وبيكربونات الصودا ويترك
لفترة ثم يغسل.

الترموس :

- قبل استعمال الترموس لأول مرة أو لإزالة رائحة غير مستحبة فيه توضع
ملعقة من بيكربونات الصودا في القارورة وتملأ بماء دافئ وترج القارورة جيداً
وتترك لليوم التالي قبل غسلها.

القناني البلاستيكية :

- للتخلص منها بسهولة يصب فيها كمية من الماء المغلي فيعمل على تليين
البلاستيك مما يسهل تطبيق القنينة فبهذه الطريقة لا تأخذ مساحة كبيرة في
كيس القمامة.

المقص في المطبخ :

- وجود مقص خاص للمطبخ ضروري جداً ويسهل كثيراً القيام بكثير من الأعمال
مثل تقطيع الدجاج وإعداده للطبخ وقص الدجاج المطبوخ وقص الخبز وغيره من
العمليات الأخرى الكثيرة فعدا عن تسهيل هذه العمليات فإنه يقوم بالتقطيع
بشكل أجمل وأسرع.

سآجدْ للهْ
2012-02-07, 22:04
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

السلام عليكم ورحمة الله

(مَنْ قَعَدَ مَقْعَدًا لَمْ يَذْكُرْ اللَّهَ عَزَّ وَجَلَّ فِيهِ كَانَ عَلَيْهِ حسرة وندامة يَوْمَ الْقِيَامَة)
فكم خانَ لفظٌ معناه..وإذا ما عجز عن بَوْحِه اللسان.. فالله يعلم القلبَ ونجواه..

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-07, 22:17
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قيل الأنسان الذي لايكمل عمل اليوم..
لايستحق ان يتكلم عن أحلامه


من الصعب..حقآ حينما نريد ان نقوم بأي عمل..
نجد الفوضى تعم المكان


فلكل شيئ مقومات... والذوق والترتيب .. يساعد كثيرا
في تقديم إنجاز أسرع..
اتأمل حياتهم ..
اجدهم متذبذبين..
يعيشون في تخبط..
أعجب من حالهم حقآ..
تريب الأوراق..
ربما هو عنوان غريب..
لكن واقعه يعيش بيننا اليوم..
لم يكتفي البعض بالصعود الى مقصلة العمر ( وهو تضييع الوقت..)
بل عاش حياته.. مابين بعثرة اوراق... وانزعاج من كل شيئ..
فليس غريب ان ينتج عن ذلك كله ( حياة الملل)
تلك الحياة التي اجد شباب وفتيات هذه الأمه يعيشونها..
أسفه إنني اطرق بقلمي.. تلك الكلمات
ولكن آن الآوان ان نعيد ترتيب أوراقنا ..
أي اوراق اقصد..؟
إنها أولوياتنا في هذه الحياة ..
لماذا التخبط اصبح رفيق الكثير اليوم؟؟
لااجدهم يعيشون روعة معنى ( هدفي في هذه الحياة)؟؟؟
ربما ينقصنا الصمود من أجل تحقيق تلك الاهداف..

http://faculty.ksu.edu.sa/alwadani/Pictures%20Library/_w/%D8%A7%D9%84%D9%87%D8%AF%D9%81_jpg.jpg (http://faculty.ksu.edu.sa/alwadani/Pictures%20Library/%D8%A7%D9%84%D9%87%D8%AF%D9%81.jpg)

ترتيب الأهداف لابد منه..حتى نصل الى غايتنا المنشوده
سمعتها من دكتور في التنميه البشريه ( قال
ضع هذه الاسئله نصب عينيك ..وأجب عليها
فانها تساعدك في تحقيق هدفك
( ماذا اريد من هذه الحياة ؟؟
كيف احصل على ما أريد؟؟
متى احصل على ماأريد.؟؟

نعم فالاحلام والاهداف الشيئ الأهم في حياتنا..
فهي تبني مستقبلنا بناء صحيح.
وكما قيل...
الحلم هو الخيط الذي نحيك
به أجمل وأعظم قصص الحياة


ليجلس كل منا وليسئل نفسه..
ماهدفي من هذه الحياة ؟؟
واين وصلت في طريقي لهدفي؟؟
وهل جعلت من هدفي سببا لنصرة ديني وأمتي؟؟

لا يدرك المجد من لا يركب الخطرا.. .. ولا يـنال العـُلاَ مــن قـدَّم الحـذرا
ومـن أراد العــُلا صـفـوًا بـلا كَــدَرٍ.. .. قَضَى ولم يقضِ من إدراكه وَطَرا

أسطر اختلجت وجداني..
وانا أرتب أوراقي..

عمر بن عبد العزيز
خامس الخلفاء الراشدين يقول معبرا عن طموحه :

" إن لي نفسا تواقة ،
تمنت الإمارة فنالتها،وتمنت الخلافة فنالتها ،وأنا الآن أتوق
إلى الجنة وأرجو أن أنالها "

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-07, 22:46
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قيل ان الذكريات
إنها تلك الخطوط الرفيعة الشفافة ،،
التي تخطها اللحظات والسنون ،
تترك بصمتها على صفحات أيامنا ،،
وتنعش خواطرنا ،،،،، كلما كان الذهن شاردا

http://3.bp.blogspot.com/-F8zrJchoqko/TVySLyw9gBI/AAAAAAAAAE4/-wL_23Ba2V0/s200/writers-block-1024x768.jpg (http://3.bp.blogspot.com/-F8zrJchoqko/TVySLyw9gBI/AAAAAAAAAE4/-wL_23Ba2V0/s1600/writers-block-1024x768.jpg)

دفتر صغير.. حوى بداخله..
امتزجت بين ألم وأمل
وحزن وفرح
ودمعات وضحكات
ذكريات فيها من البشرى والتنبيه..
لايخفى عن الكثير اليوم..
ماحصل من احداث .. لم نكن نتوقع حصولها يومآ..
احداث عرفها الصغير قبل الكبير..
وهنا سوف اختصر مامر به العالم..
من دفتر ذكرياتي..
ذكريات الثورات...والثروات..
http://ainnews.net/wp-*******/uploads/2011/01/news316.jpg (http://www.egy3rb.com/showthread.php?t=26887)

في ارض تونس تعالت الصيحات..
لتعلن كفى فقد سئمنا الظلمات..
منع حجاب ونقاب واذان يرفع للصلوات..
فنطلقت صرخات محت كل البغي والظلمات..
واليوم عاد النقاب والحجاب في الجامعات..

وفي ارض الكنانة.. تلاطمت امواج الأمس..
امام ناظري..
واعاد التأريخ نفسه..
فتذكرت قول الشافعي رحمه الله حينما سئل
نسأل الله ان يمكننا ام يبتيلنا
قال لن تتمكنوا حتى تبتلوا..
فمن البلاء .. خرجت عزيمة
لاخوف بعد اليوم..
وآن الآوان ان يرحل كل من ظلم..
حينها استشعرنا قول الله تعالى
( يعز من يشاء ويذل من يشاء)

وهناك من تلك الارض
التي صدحت بها مقولة ذلك الرجل المغوار
المجاهد عمر المختار
حينما قال/ نحن لن نستسلم ننتصر او نموت..
صبرتم كثيرا على حاكم
لا يكفي ان نسميه احمق.
وأقر الله أعينكم به
فلله الحمد والمنه..
وهنا صدق الشاعر اذ يقول..
وما من يد الا يد الله فوقها..
http://www8.0zz0.com/2011/12/03/15/145207173.jpg (http://www.3mri-qtr.com/vb)

وفي ليالي رمضان وعند مائدة الافطار
نسمع استغاثة اهل الشام
ان هلموا امة الاسلام..
فقد رأينا ابشع الظلام..
ممن يسمي نفسه بشار بل هو نشار
لاادري تلك الاستغاثات..
ادمعت المآقي..
وتذكرت حينها ارض العراق
http://www.ct-7ob.com/vb/imgcache/131074.png (http://www.klam-iq.com/vb)
تلك التي عانت ولازالت تعاني
من مذهب رافضي خوانِ
هذا ماحصل من ثورات في اراض عربيه اسلاميه..
ولكن هنا لنقف ولنقول أي ثروات خلفت
تلك الثورات..
اولا/ كسر وقتل ذلك القاتل ..
الذي حول حياة الكثير منا الى غابه موحشه
انه الخوف تجاوزنا ولله الحمد ذلك الجدار

ثانيا/ يبدوا ان شباب الأمة وعى وادرك
مايجب ان يسعى إليه..
ثالثا/ آن الآوان ان نضع بصمة في رقي امتنا..
ونصرة ديننا ..
وكثير هذه الثروات
وهذه من اهمها..
واجتمعت تلك الدول جميعا تحت راية

واجد من بين صفحات الذكريات..
عنوان عنونته ( بالتنبيهات)
فكتبت قائله..
حينما هبوا للتغيير
كانوا شجعان ... فغيروا الانظمه .. وقهروا ذلك
كله ليس بالاسلحه .
بإرادتهم .. .
عزمهم ..


نعم النفس تعطينا من الهمه بقدر مانحدد لها من الغرض

ولكن اخوة الايمان اخوات العقيده

اليوم نحن بأشد الحاجه الى ثورة من نوع اخر..

ثورة لو نجحنا بها لن يكون التغير فقط في مجتمعاتنا
بل سيكون التغير جذري تغير سنرقى به عاليا
تغير سنحيا به حياة رائعة جميله
اه مااحوجنا إلى هذه الثوره

إليكم عنوانها : ثورة الاستيقاظ قبل الرحيل
مطالبنا :
1_ اصلاح النفس
2_ إعادة امجاد المسلمين
3_قرأء الكتب يأمة اقرأ
4_عمل الخير في كل لحظه
5_عهد نأخذه على انفسنا بعدم اضاعة وقتنا
6_ الامر بالمعروف والنهي عن المنكر
7_ الدعوه الى الله اينما كنا
8_ بر الوالدين
9_ نصرة اخواننا المجاهدين في اي وقت واي وسيلة تتوافر ليدنا

" نعم هذه هي مطالبنا

وهذا هو شعارنا "


انها ثورة للتغيير نفوسنا

واعلموا انه من احبه الله استعمله في طاعته وجعله لايعيش لنفسه فقط .. بل يعيش لدينه
داعيا إليه امرا بالمعروف نهايا عن المنكر
مهتما بأمر المسلمين
ففي الشيشان اخته
وفي الافغان امه
وفي فلسطين ابنته
وفي العراق احبابه
يألم لألمهم ويفرح لفرحهم
اذا رأى المنكرات امتلأ قلبه حسرات
وفاضت عيناه بالدمعات":

الابطال حقا : هم الذين تعرض عليهم الشهوات وتتدافع عليهم المحرمات فيفرون الى الله منها وتغلب عليهم محبته وتحيط بهم قوته..

اذا فلنكن ابطالا ..

لان الابطال : ليس عندهم مجال للموازنه بين الدين والدنيا يختارون هذه تاره وتلك تاره الدين عندهم مقدم ابدا لايخشون لأجله احد
فلنأخذ عهدا على انفسنا ان نكون ابطالا
تبكي السماء لفقدنا
وتحزن الارض لفراقنا ولايزال الاسلام ينتظر امثالنا
الى هنا انتهت صفحات التنبيهات..

بقى صفحتين من ذكريات عام


صفحة قد رسمت عنوانها

بـ( حينما فقدوا الهويه ضاعت القضيه)

رأينا انتشار وامتداد تلك النيران

انها نيران إيران تلك التي تسعى ان تحرق

الاخضر واليابس..

( اهل السنة اليوم يعانون من فقد الهويه.. فحينما فقدت الهويه ضيعوا القضيه..
لااقصد هنا هوية كل منا .. تلك التي يقال عنها شهادة الميلاد..
كلا: الهويه هي ( الاتباع الحقيقي / لدين الاسلام)

اما آن الآوان ان نعرف أبنائنا عن مذهب الرافضه..؟؟
اما آن الآوان ان نعيد تفكيرنا ونجدد اهدافنا؟
اما آن الآوان ان نطفئ ونخمد تلك النار..؟؟
http://www.qa44.com/powerpoint/wp-*******/uploads/188%D9%85%D8%A7%D8%A1-224x300.jpg (http://www.qa44.com/powerpoint/wp-*******/uploads/188%D9%85%D8%A7%D8%A1.jpg)

بماء التوحيد الخالص.. والاتباع الحقيقي..
لن نستطيع ان نحرر العراق والاحواز وكل ارض يعانون اهل السنة\
من هذا المذهب الرافضي
الا الا بعدما نحقق كلمة الهويه..
فيحنها ننصر القضيه...
ولازال للكلام بقيه.."

واخر صفحة .. كان عنوانها

إرث لايمكن جمعه خسئتِ ياامريكا..

كتبت بها.. مايلي..

قال سيد قطب رحمه الله إن أصحاب الأقلام يستطيعون أن يصنعوا شيئاً كثيراً ، ولكن بشرط واحد : أن يموتوا هم لتعيش أفكارَهم من لحومِهم ودمائِهم .. أن يقولوا ما يعتقدون أنه حق ويُقدّموا دمائهم فداء لكلمة الحق ..
إن أفكارنا وكلماتنا تظلّ جثثاً هامدة ، حتى إذا متنا في سبيلها وغذّيناها بالدماء ، انتفضتْ حيّة ، وعاشت بين الأحياء

كلنا نرحل عن هذه الدنيا ويترك إرث
لااهله .. ولكن
صعب ان يرحل شخصا .. ويترك أرثا لكل الناس ..
وهذا لم اجده الا بذلك الاسد المغوار..
حقا كما قيل ..
إن العظماء يدخلون الدنيا كما يدخلها الناس ، ولكنهم يأبون أن يخرجوا منها كغيرهم

فخرج من هذه الدنيا وهو يترك إرث للملايين من الناس..

اعجز ماذا اقول .. فجف الحبر ياابا عبدالله
شعري واحرفي باتت خجلة .. كيف لها ان تصف أميرها
جزاك الله عنا وعن المسلمين خيرا
فأن قتلت فإرثك الذي تركته كثير وكبير على الامة اجمع
افكارك ستبقى نورا تضيئ لنا الطريق
خسئت ياامريكا فأن فرحت اليوم بمقتل هذا البطل
فاأمة االإسلام ولود لا تعقم أبداً
سيولد الف من ابا عبدالله .. ولكن صبرا..
فأن فرحت ِ ساعه ستحزني ساعات وسنين
إذا سيّدٌ منّا خلا قام سيّدٌ ... قؤوول لما قال الكرام فعولُ

وسنظل نقول الابطال يغيبون لكن لايموتون
وهنا اغلق دفتر ذكريات
http://img206.imageshack.us/img206/2030/187255874d6f25f67b1bwe3.jpg (http://img206.imageshack.us/img206/2030/187255874d6f25f67b1bwe3.jpg)

عام 2011 ..
املآ بصفحات مشرقه في عام 2012 ان شاءالله

لنردد ونقول..
سوف نبقى هنا كي يزول الالم
سوف نحيا هنا سوف يحلو النغم
رغم كيد العدا رغم كل النقم
سوف نسعى الى ان تعم النعم
سوف نرنو الى رفع كل الهمم
للمسير للعلا ومناجاة القمم
فلنقم كلنا للدواء والقلم
كلنا عطف على من يصارع السقم
ولنواصل المسير نحو غاية اهم
ونكون حقا خير امة بين الامم .


|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-07, 22:53
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

«•• اسألْ ربك على قدر ما تظنه فيه ••»

قال الله عز وجل:
{ قَالَ رَبِّ اغْفِرْ لِي وَهَبْ لِي مُلْكاً لَّا يَنبَغِي لِأَحَدٍ مِّنْ بَعْدِي إِنَّكَ أَنتَ الْوَهَّابُ}
(35) سورة ص.
إذا جئت تسأل الله فلا تسأل الله على قدر ما تظنه في الناس ولكن اسأل الله على قدر ما تظنه في ربك
الله جل وعلا أعظم مسئول
هذا سليمان يفقه هذه جيدًا فلما سأل ربه سأل ربه على قدر ما يعلمه عن ربه، لا ما قدر ما يستحقه
فنحن لا نستحق شيئا لكننا نسأل الله على قدر علمنا بعظمة ربنا وجلال قدرته وأن خزائنه لا تنفد سبحانه وتعالى.
فهذا النبي الصالح قال {رَبِّ اغْفِرْ لِي وَهَبْ لِي مُلْكًا لَّا يَنبَغِي لِأَحَدٍ مِّنْ بَعْدِي إِنَّكَ أَنتَ الْوَهَّابُ}
فمنّ الله جل وعلا عليه وأعطاه ما سأل
{فَسَخَّرْنَا لَهُ الرِّيحَ تَجْرِي بِأَمْرِهِ رُخَاء حَيْثُ أَصَابَ} (36) سورة ص ،
حتى أصبح في الأمثال يقال ملك سليمان كناية عن الملك العظيم الذي لا يعطى لأي أحد وهذا فضل من الله جل وعلا له.

تأملات قرآنية
للشيخ صالح المغامسي - يحفظه الله -

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

2012-02-07, 22:54

كيف حالكم احبائي ارى اليوم ان عدد المشاركات قليل ترى ما السبب؟؟؟
اليوم كنا في توديع جدتي حفظها الله الى البقاع المقدسة لاداء العمرة لهذا لم ازركم .......
لقد طلبت منها ان تدعوا لاحبائي في منتدى الجلفة وهي في الحرم ...
ادعوا الله ان تعود لنا سالمة غانمة ....
لي عودة بعد تكملت قراءة المشاركات...

سبحان الله .... وانا ايضا كنت منشغل بوالدة زميلي وصديقي انتظرناها لتركب في الحافلة من وكالة السياحة ولم اشارك سوى الصباح .......
ولكن انت افضل مني فقد طلبت منها الدعاء لأحباب منتدى الجلفة أما انا فطلبت منها تخصيص دعوة لي فقط ....

سآجدْ للهْ
2012-02-07, 22:57
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

------ [ السّلامُ عليْكُم ] -----


بقول الله تعالى :
" وَمَا خَلَقْتُ الْجِنَّ وَالْإِنْسَ إِلَّا لِيَعْبُدُونِ "


ويقول سبحانهُ في مُحكمِ تنْزيله :
" اعْلَمُوا أَنَّمَا الْحَيَاةُ الدُّنْيَا لَعِبٌ وَلَهْوٌ وَزِينَةٌ وَتَفَاخُرٌ بَيْنَكُمْ وَتَكَاثُرٌ فِي الْأَمْوَالِ وَالْأَوْلَادِ
كَمَثَلِ غَيْثٍ أَعْجَبَ الْكُفَّارَ نَبَاتُهُ ثُمَّ يَهِيجُ فَتَرَاهُ مُصْفَرًّا ثُمَّ يَكُونُ حُطَامًا وَفِي الْآخِرَةِ عَذَابٌ
شَدِيدٌ وَمَغْفِرَةٌ مِّنَ اللَّهِ وَرِضْوَانٌ وَمَا الْحَيَاةُ الدُّنْيَا إِلَّا مَتَاعُ الْغُرُورِ "


إنّها الدّنْيا وحُطامها الفاني ...
واغْتنامُ الحياةِ فيها قبْلَ الممات
والعَمل فيها قبْل الفوات فمَا هيَ إلّا رحْلةٌ لعبادِ الله
رحْلةٌ لدارِ القَرار ... والرّحلةُ تحْتاجُ زاد ... زادٌ كثيرٌ ليَكْفي رحْلة الحساب
لهذا ما جُعلت الدّنْيا إلّا لكسْب الحسنات فيهَا وجَمْع الزّاد

ولو تأملّنا حياةَ المُسْلمِ فيهَا ...

لماذَا وَجدْنا ...؟!

لوجدنَاهَا حياة يَقْظةٍ دائمة وربْحُها مستمّر
يَوْمها خيْرٌ من أمْسهَا ... وغَدُها خيرٌ من يوْمهَا


ولأنّها حياةُ المُصْطفين الأخْيار ...
عبادُ الله الأبْرار ... ما رأيْناهُم ينامونَ ولا يَلْعبون
بل يُسبّحونَ ويذْكرونَ ويَسْتغفرونَ الله باللّيلِ والنّهار

ولأنّها حياةُ رسولنا الحبيب ...
فقد كانَ يَقِظَ القلبِ والعَقْل تنامُ عينهُ
وقلبهُ لا ينام وهُوَ الذي غُفرَ له ما تقدّم منْ ذنبهِ وما تأخر


ولأنها حياةُ أهْل الجنّة ...
فالجنّةُ تسْتحقّ البَذْلَ والعَطاء والكَثير منَ التّضْحية
فلا نَومٌ فيها ولا ممات ... دارُ المُقام الأمين ...

ولأنّها حياةُ التّكليف ...
والجدّ والعَمل والاجْتهاد يقولً الله تعالى :
" فَمَنْ يَعْمَلْ مِثْقَالَ ذَرَّةٍ خَيْرًا يَرَهُ * وَمَنْ يَعْمَلْ مِثْقَالَ ذَرَّةٍ شَرًّا يَرَهُ "


ولأنّها حياةُ الغَنيمة لمَن اغْتنمها ...
وفُرصة لمَن كسبَها ... واهْلُ هذه الحياةِ قلّة
لأنّهم آمنوا بالله وعملوا الصّالحات وتجنّبوا المُهْلكات

واهْل الإيمانِ قليل ...
وقلّة لأنّهم شكروا الله تعَالى بجوارحهم
وقلوبِهم وألْسنَتُهم ... لمَا وهبهم الله إيّاهُم من نِعَم

وأهْلُ الشّكر قليل ...
يقولُ الله تعالى :
" وَقَليلٌ مِن عِباديَ الشَّكُور "


وقلّة لأنّهم غُرباء ...
كالشّعرةِ البيْضَاء في الثّور الأسْود
أو كالشّعرة السّوْداء في الثّور الأبْيض
غُرباء ... لأنّهم الثابتونَ في زَمن الفتن المُصْلحونَ لمفاسد النّاس
والذينَ يَصْلحونَ عنْدما يَفْسَدُ النّاس ...

غُرباء لأنّهم قلّة مؤمنة ...
طائعة لله بينَ جَمْعٍ يَعْصونَ الله
ويَتوبونَ في زمنٍ ضاعت فيهِ الحُقوق وتأنيبُ الضّمير للنّفْس
الأمّارة بالسّوء ...

هُم قلّة ...
لأنّهم ذاقوا حلاوة الإيمان
وعَلموا المُرادَ من خلْقهم بطاعة الله وأوامره واجْتنابِ نواهيه
ومكارهه ... فتَراهم يَصْفحونَ ويُسامحونَ ويكْظمونَ الغَيظَ ويعْفون
ليكونوا منَ المُحْسنين ...‘

فقد علموا أنّ الله ناظرٌ لهم ...
وانّ جوارحُهم شاهدة عليْهم ... فخافوا الله سرّاً وعَلناً
وجَمعوا خيْرَ الزّادِ وحفظوا الله تعالى ليَحْفظهم يومَ تشْخصُ فيه الأبْصار

فتركوا الدّنْيا وملذّاتها ...
فجمعَ الله لهُم شَملهم ... وجعلَ غناهُم في قلوبهم
وأتتهُم الدّنْيا وهيَ راغمة ... فرزَقَهُم من حيثُ لا يحْتسبون

إنّها حياةُ / الغُرباء /
[ فطُوبَى للغُرباء ...)

وعَذبُ التّحَاياَ لكُم
بقلمـِ أختكنّ : مَن تسألُ المَولَى لغروبٍ لهَا هُوَ النّدَى
نَديّة الغُرُوب

--- [ في أمَان الله ] -----

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

2012-02-07, 22:57
الاخ ساجد الى الله لو تفضلت وتكرمت ان تنقص من حجم الصور التي تضعا فهي تثقل تصفح الموضوع او قلل من وضع الصور والجميع يعاني من ثقل تصفح المنتدى .... دمت طيب

سآجدْ للهْ
2012-02-07, 23:04
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

الآآآن قــــفــ ..!!!!
http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc3/16749_370062715293_318814280293_10117672_3390749_n .jpg

{ صلِ على النبي المصطفـــــــــى }


والآن قم بالإستغفــآآر الــى مــآآشااء الله


|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-07, 23:07
الاخ ساجد الى الله لو تفضلت وتكرمت ان تنقص من حجم الصور التي تضعا فهي تثقل تصفح الموضوع او قلل من وضع الصور والجميع يعاني من ثقل تصفح المنتدى .... دمت طيب

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
نعم بكل سرور ..,, سأتوقف عن ادراج الصور.. :19::19:

وفقك الله :34:

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-07, 23:15
سبحان الله .... وانا ايضا كنت منشغل بوالدة زميلي وصديقي انتظرناها لتركب في الحافلة من وكالة السياحة ولم اشارك سوى الصباح .......
ولكن انت افضل مني فقد طلبت منها الدعاء لأحباب منتدى الجلفة أما انا فطلبت منها تخصيص دعوة لي فقط ....
فعلا سبحان الله
ما عليش كي تدعي و ربي يستجيب لها راها زايدة فينا....
المهم قول لصديقك كي يحكي مع امو يقوللها تدعيلنا و يتحل المشكل ....

سآجدْ للهْ
2012-02-07, 23:18
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

شكراا اخت بيرلآ راكي توصي علينا..

ربي يرزقك ما تتمناي..
وان شااء الله الحج المبرور
و يرزقك اعالي الجنان والرضوان

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-07, 23:23
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

شكراا اخت بيرلآ راكي توصي علينا..

ربي يرزقك ما تتمناي..
وان شااء الله الحج المبرور
و يرزقك اعالي الجنان والرضوان

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
اخي هي كي ولات رايحة قالتلنا كل واحد وش يحوس نجيبلوا معايا حاجة انا قلتلها ادعيلي ربي كي تولي عند الكعبة و ادعي لكل احبابي الي نعرفهم وحسبتهملها بالاسم و ذكرت احبابي في المنتدى ...
اللهم آمين يارب لنا ولجميع المسلمين والمسلمات

سآجدْ للهْ
2012-02-07, 23:36
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آآجماعة ما معنى الظاهرية لم افهم شيئا..!!!!

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-07, 23:39
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آآجماعة ما معنى الظاهرية لم افهم شيئا..!!!!

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
اخي انا ايضا لم افهم

سآجدْ للهْ
2012-02-07, 23:41
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قرأت موضوع [هذه سلفيتي]

تقريب لم افهم شيء [اللغة العربية التي يتكلمون بهآ قوية جداا..] ترىما السبيل التي توصل الى ذلك ؟؟

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-08, 00:06
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قرأت موضوع [هذه سلفيتي]

تقريب لم افهم شيء [اللغة العربية التي يتكلمون بهآ قوية جداا..] ترىما السبيل التي توصل الى ذلك ؟؟

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
اخي هل تقصد السبيل التي توصلك لآن تكون لغتك العربية قوية؟؟؟
اولا انت ما زلت صغيرا ومع الوقت ستكتسب مهارات لغوية و مصطلحات جديدة يوم بعد يوم......
و ثانيا عليك بالمطالعة من الكتب و ليس من الانترنت فهي جد مفيدة لكسب لغة جيدة...

سآجدْ للهْ
2012-02-08, 00:14
اخي هل تقصد السبيل التي توصلك لآن تكون لغتك العربية قوية؟؟؟
اولا انت ما زلت صغيرا ومع الوقت ستكتسب مهارات لغوية و مصطلحات جديدة يوم بعد يوم......
و ثانيا عليك بالمطالعة من الكتب و ليس من الانترنت فهي جد مفيدة لكسب لغة جيدة...

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
نعم ذلك هو
ان شااء الله

آه كنت اظن اظن انني سأكتسب من الانترنت ...
إذن الكتب,, أي كتب يمكنك ان تنصحيني بهآ ؟ إن لم يكن لديك مانع

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-08, 09:57
السلام عليكم ورحمة الله تعالى وبركاته
صباحكم سعيد و ايامكم اسعد
يبدو ان اهل الدار خاجها اليوم او ربما انتم مشغولين بأمور اخرى فقط نرجو ان لا تطيلوا الغياب علينا ...
فالدار بلا بيكم سامطة

آلاء الرحـــــــمن
2012-02-08, 10:01
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
نعم ذلك هو
ان شااء الله

آه كنت اظن اظن انني سأكتسب من الانترنت ...
إذن الكتب,, أي كتب يمكنك ان تنصحيني بهآ ؟ إن لم يكن لديك مانع

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
اخي اقرأ ما يوافق مستواك الفكري و قدرة عقلك على الاستيعاب ...فأنت مازلت صغير و لا يجب ان يلهيك هذا عن دراستك ...
اولا القرآن العظيم فيه من الكنوز اللغوية ما الله به عليم اقرأه بتمعن و هدوء وستتعلم منه الكثير عن اللغة...
و اقرأ كتب التفاسير الميسرة ....
تغيب عني العنواين ولكني سأبحث لك عن ما سيفيدك

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-08, 10:13
السْسَلآَمُ عَلَيْكُمْ ، صَبَآحُ الخَيْرْ لِجَمِيييع أَهْلِ الدَّآرْ

عَلِمْتُ انَّ عِطْرَ المَلِكَة تَعشقُ القِطَطْ ، فأَتَيْتُهآ بهديَّتَيْنْ :)



محمد جديدي التبسي
2012-02-08, 10:42
قال إبن القيم رحمه الله :

حال العبد في القبر كـ حال القلب في الصدر ..!

{ نعيماً ، وعذاباً ، وسجناً ، وإنطلاقاً }

فــ إذا أردت أن تعرف حالك في قبرك ..

فــ انظر إلى حال قلبك في صدرك ..

اللهم أصلح لنا قلوبنا ,, ويسر لنا أمرنا

وأهدنا الى طاعتك {♥}

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/431556_227601513999437_100002487701654_514490_1243 989837_n.jpg

محمد جديدي التبسي
2012-02-08, 10:48
أحب من لا يموت

وجد شيخ رجلا يبكي على قبر فقال له : يا هذا ما يبكيك؟ فقال: أبكي على من أحببت ففارقني !

فقال له الشيخ : ذنبك أنك أحببت من يموت، لو أنك أحببت الحي الذي لايموت لما فارقك أبدآ فما باقي إلا وجهه سبحانه وتعالى.

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/425149_227582280668027_100002487701654_514437_1352 990440_n.jpg

عطر الملكة
2012-02-08, 10:57
السْسَلآَمُ عَلَيْكُمْ ، صَبَآحُ الخَيْرْ لِجَمِيييع أَهْلِ الدَّآرْ

عَلِمْتُ انَّ عِطْرَ المَلِكَة تَعشقُ القِطَطْ ، فأَتَيْتُهآ بهديَّتَيْنْ :)



و عليكم السلام و الرحمة و الاكرام
يسعد صباحك
بالرغم انه لم يكن لدي اي رغبة في كتابة اي رد
لكن لما رأيت الهدية الجميلة لم اتردد في ان اشكرك خالص شكري و امتناني
عجبني هذ القط
شكله ذواق و له اذن موسيقية

و هذ القط شكله يريد النوم فكرني بحالي في هذه الايام الباردة
و الله هدية حلوة من اخت كلها ذوووووق و رقي
احبك في الله دمتب بود

مجيد حـ
2012-02-08, 11:01
سلام عليكم
نتاعش هذا الموضوع ؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟

محمد جديدي التبسي
2012-02-08, 11:03
إقرأ هذه القصة :

لما رجع عمر بن الخطاب رضي الله عنه من الشام إلى المدينة المنورة إنفرد إلى الناس ليتعرف أخبار رعيته ، فمر بعجوز في خبائها فقصدها ، فقالت : يا هذا ، ما فعل عمر ؟
قال : قد أقبل من الشام سالما.
فقالت : لا جزاه الله عني خيرا.
قال : ولم ؟!
قالت : لأنه والله ما نالني من عطائه منذ ولي أمر المؤمنين دينارا ولا درهما.
فقال : وما يدري عمر بحالك وأنت في هذا الموضع ؟!
فقالت : سبحان الله ! والله ما ظننت أن أحدا يلي أمر الناس ولا يدري ما بين مشرقها ومغربها.
فبكى عمر رضي الله عنه ، وقال "في سره" : واعمراه ! كل أحد أفقه منك يا عمر !
ثم قال لها : يا أمة الله ، بكم تبعيني ظلامتك من عمر ، فإني أرحمه من النار ؟
فقالت : أتهزأ بنا يرحمك الله !
فقال : لست بهزاء ، فلم يزل بها حتى اشترى ظلامتها بخمسة وعشرين دينارا.
فبينما هو كذلك إذ أقبل علي بن أبي طالب وإبن مسعود رضي الله عنهما ، فقالا : السلام عليك يا أمير المؤمنين.
فوضعت المرأة يدها على رأسها وقالت : واسوأتاه ، شتمت أمير المؤمنين في وجهه !
فقال لها عمر رضي الله عنه : لا بأس عليك رحمك الله.
ثم طلب رقعة يكتب فيها فلم يجد ، فقطع قطعة من مرقعته وكتب فيها :
"بسم الله الرحمن الرحيم ، هذا ما اشترى عمر من فلانة ظلامتها منذ ولي إلى يوم كذا وكذا بخمسة وعشرين دينارا ، فما تدعي عند وقوفها في المحشر بين يدي الله تعالى فعمر منه بريء ، شهد على ذلك علي بن أبي طالب وابن مسعود رضي الله عنهما"

( الدميري : مجلد 1 ، ص 73 )

معاً إلى الله
2012-02-08, 11:26
رسالة لأسرة الدار داركم الطيبين
هل لكم إخوتي أن تدخلوا لهذا الرابط؟؟؟؟؟
وأجركم على الله

إبريق تسخين الماء: أباريق تسخين الماء العادية أو الكهربائية تتعرض لتكون طبقة من الترسبات والتكلس ومن الممكن التخلص من هذه الترسبات بسهولة بالطريقة التالية : - توضع كمية قليلة من الخل في الإبريق ويسخن قليلاً ويخض الإبريق جيداً ويترك بعض الوقت ثم يغسل.

- إذا لم تنجح هذه الطريقة وكانت الترسبات سميكة يمكن أن يوضع في
الإبريق كمية من الماء والخل "بنسب متساوية" ويسخن الإبريق حتى يغلي
لمدة قصيرة "حوالي 5 دقائق" ثم يترك حتى اليوم التالي فيعمل الخل على
تحليل الترسبات.

لوح شوي اللحوم :

- لتفادي التصاق الطعام على اللوح يدهن الشبك ببعض الزيت قبل القيام
بعملية الشوي.
- لتنظيف اللوح المتسخ يرش وهو ساخن بصابون الغسيل أو الصابون
المستعمل في الجلاية ثم يغطى بمحارم ورقية رطبة ويترك لفترة من الزمن
حتى تتحلل الأوساخ والدهون وتحتاج العملية للقليل من الفرك ويفضل
استعمال فرشاة معدنية لفركه إذا كان شديد الاتساخ.

الخلاط الكهربائي :

- لتنظيف الخلاط الكهربائي بسرعة وسهولة يملأ نصفه بماء دافئ ويضاف إليه
القليل من منظف الجلي. ويمكن إضافة القليل من الخل إذا كان الخلاط قد
استعمل لخلط مادة تحتوي على الدهون ثم يغطى الخلاط ويشغل لبضع ثواني
وبعد ذلك ينظف بالإسفنجة ويشطف بالماء.

الخفاقة الكهربائية :

- يفضل نقع اللولب المعدنية فور الانتهاء من استخدامها في ماء بارد ثم تغسل.
- تنظف الخفاقة بإسفنجة مرطبة بالماء وبيكربونات الصودا وتجفف ويمكن
استعمال فرشاة أسنان قديمة لتنظيف الحواف والزوايا الصغيرة لإزالة بقايا
الطعام المخفوق.

ألواح التقطيع :

- للتخلص من رائحة البصل والثوم والسمك وغيرها عن اللوح يفرك بنصف
ليمونة أو يوضع عليه طبقة من معجون معد من الماء وبيكربونات الصودا ويترك
لفترة ثم يغسل.

الترموس :

- قبل استعمال الترموس لأول مرة أو لإزالة رائحة غير مستحبة فيه توضع
ملعقة من بيكربونات الصودا في القارورة وتملأ بماء دافئ وترج القارورة جيداً
وتترك لليوم التالي قبل غسلها.

القناني البلاستيكية :

- للتخلص منها بسهولة يصب فيها كمية من الماء المغلي فيعمل على تليين
البلاستيك مما يسهل تطبيق القنينة فبهذه الطريقة لا تأخذ مساحة كبيرة في
كيس القمامة.

المقص في المطبخ :

- وجود مقص خاص للمطبخ ضروري جداً ويسهل كثيراً القيام بكثير من الأعمال
مثل تقطيع الدجاج وإعداده للطبخ وقص الدجاج المطبوخ وقص الخبز وغيره من
العمليات الأخرى الكثيرة فعدا عن تسهيل هذه العمليات فإنه يقوم بالتقطيع
بشكل أجمل وأسرع.

السّلام عليكم ورحمة الله وبركاته
جزيتم خيرا جميعا أيّها الجمع الطيب المبارك ..
ونعتذر عن قلّة مشاركة إخواننا وأخواتنا ...

قال الشَّيخ البشير الإبراهيمي رحمه الله: (http://www.rayatalislah.com/faidah.php?id=9)
«والشَّباب المحمَّدي أحقُّ شباب الأمم بالسَّبْقِ إلى الحياة، والأخذ بأسباب القوَّة؛ لأنَّ لهم من دينهم حافزًا إلى ذلك، ولهم في دينهم على كلِّ مَكْرُمَةٍ دليلٌ، ولهم في تاريخهم على كلِّ دعوى في الفخار شاهدٌ.
أعيذُ الشَّباب المحمَّدي أن يُشْغِلَ وقتَه في تِعْدَاد ما اقترفه آباؤُه من سيِّئات أو في الافتخار بما عملوه من حسنات، بل يبني فوق ما بَنَى المحسنون ولْيَتَّقِ عثرات المسيئين.
وأُعيذه أن ينام في الزَّمان اليقظان، أو يَهْزَلَ والدَّهر جادٌّ، أو يرضى بالدُّون من منازل الحياة.

يا شباب الإسلام! وصيَّتي إليكم أن تتَّصلوا بالله تديُّنًا، وبنبيِّكُمْ اتِّباعًا، وبالإسلام عملًا، وبتاريخ أجدادكم اطِّلاعًا، وبآداب دينكم تخلُّقًا، وبآداب لغتكم استعمالًا، وبإخوانكم في الإسلام ولِدَاتِكم في الشَّبيبة اعتناءً واهتمامًا، فإنْ فعلتم حُزْتُمْ منَ الحياة الحظَّ الجليلَ، ومن ثواب الله الأجرَ الجزيلَ، وفاءت عليكم الدُّنيا بظلِّها الظَّليلِ».
[مكة المكرمة: في 1 صفر الخير 1372هـ]

مَشْكُورَة جِدًّآ علَى الرَّأيْ الصَّرِيحْ

صَرَآحَة ! أَنآ الوَحِيدْة فِي البَيْتْ التِي أكْرَه الضُّيُوف و خَآصَّةً الصِّغآرْ :cool:

وَسبب هَذآ الكُرْه ~ مَوْقِفْ حَدَثَ لِي فِي بَيْتِ جدِّي ، حَيْثُ أُقِيمَت [عَرْضَة بين الأَقَآرِبْ] فَحَضَرَتْ 4 أَخوآتْ صَغِيرَآتْ [ربي يَحفَظهم عَلى كُلِّ حآلْ] الفَرْق في عُمْرْ كُلّ وآحِدَة عَآمَيْنْ ، شَبْعُونآ المْرَآرْ :mad: ، كُنَّ مَعْرُوفآتْ بشَطآرتهنَّ حَتَّى أَنَّهنّ يَتَدخَّلْنَ فِي عَمَلِي الذِي أَقُومُ بِهِ :mad::mad:، لَيسَ هَذآ فَقَطْ ! َبَلْ أَنَّهُن اشتَرَطُن عَلَيْنآ أَن يَكُونَ ذَآكـ الطَّبق فِي وجبة الغَدَآء فانْ لَم يُحضَّرْ لَن يَتَنآولن الغَدَآءْ :mad:

كَآنَ يْومًآ مُتْعِبًآ جِدًّآ جِدًّآ

السلام عليكم

خليت البارحة صورة لأكلة قسنطينية و ربما هناك من أراد أن يعرف إسمها

http://im9.gulfup.com/2012-02-07/1328566335201.jpg (http://www.gulfup.com/show/X39qwmwtcwmub)

هي المشلوش

إن شاء الله تجيكم الفرصة و تاكلوها
لذيذة جدا :rolleyes::rolleyes::rolleyes:


كيف حالكم احبائي ارى اليوم ان عدد المشاركات قليل ترى ما السبب؟؟؟
اليوم كنا في توديع جدتي حفظها الله الى البقاع المقدسة لاداء العمرة لهذا لم ازركم .......
لقد طلبت منها ان تدعوا لاحبائي في منتدى الجلفة وهي في الحرم ...
ادعوا الله ان تعود لنا سالمة غانمة ....
لي عودة بعد تكملت قراءة المشاركات...

اذا اسمها المشلوش
اخي لو تفضلت واعطيتنا الوصفة نكون جد شاكرين صراحة اعجبني شكلها جدا

صراحة لا أعرف طريقة تحضيرها. أنا نعرف ناكل برك

ما أعرفه أنها مثل القطايف لكن أعرض يوضع عليها العسل الحر و الجوز مرحي و تأكل مع اللبن :1::1::1:

خخخخخخخخخ هذا واش نعرف

درت بحث في غوغل هاو ليك واش لقيت



رســـــــالــــــــــة أخجلتني من نفسي؟؟؟؟؟؟؟؟؟؟؟؟؟؟

هل تساءلت يوما ماذا كان سيحصل لو تعاملنا مع القرآن مثل ما نتعامل مع هواتفنا النقالة؟؟؟؟؟؟؟؟؟؟؟؟

ماذا لو حملناه معنا أينما نذهب.... فــي حقائبنا وجيوبنا؟؟

ماذا لو قلبنا في صفحاته عدة مرات في اليوم؟؟

ماذا لو عدنا لإحضاره في حال نسيناه؟؟

ماذا لو عاملناه كما لو أننا لا نستطيع العيش من دونه؟؟

ماذا لو أعطيناه لأطفالنا كهدية؟؟

ماذا لو استخدمناه عند السفر؟؟

ماذا لو لجأنا إليه عند الحالات الطارئة؟؟

هذا أمر يجعلك تتسائل "أين هو مصحفــــــي!!؟؟"

وأيضا على عكس هاتفك لا داعي لأن تخاف على قرآنك من الانقطاع

توقف للحظة وفكر ما هي أولوياتك؟؟

وافعل ما ترى إن الله يريد منك فعله

إذا كنت من الـ 7 % الذين سيدافعون عنه... قم بإعادة إرسال الرسالة لأكبر عدد ممكن.

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

السلام عليكم ورحمة الله

(مَنْ قَعَدَ مَقْعَدًا لَمْ يَذْكُرْ اللَّهَ عَزَّ وَجَلَّ فِيهِ كَانَ عَلَيْهِ حسرة وندامة يَوْمَ الْقِيَامَة)
فكم خانَ لفظٌ معناه..وإذا ما عجز عن بَوْحِه اللسان.. فالله يعلم القلبَ ونجواه..

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قيل الأنسان الذي لايكمل عمل اليوم..
لايستحق ان يتكلم عن أحلامه


من الصعب..حقآ حينما نريد ان نقوم بأي عمل..
نجد الفوضى تعم المكان


فلكل شيئ مقومات... والذوق والترتيب .. يساعد كثيرا
في تقديم إنجاز أسرع..
اتأمل حياتهم ..
اجدهم متذبذبين..
يعيشون في تخبط..
أعجب من حالهم حقآ..
تريب الأوراق..
ربما هو عنوان غريب..
لكن واقعه يعيش بيننا اليوم..
لم يكتفي البعض بالصعود الى مقصلة العمر ( وهو تضييع الوقت..)
بل عاش حياته.. مابين بعثرة اوراق... وانزعاج من كل شيئ..
فليس غريب ان ينتج عن ذلك كله ( حياة الملل)
تلك الحياة التي اجد شباب وفتيات هذه الأمه يعيشونها..
أسفه إنني اطرق بقلمي.. تلك الكلمات
ولكن آن الآوان ان نعيد ترتيب أوراقنا ..
أي اوراق اقصد..؟
إنها أولوياتنا في هذه الحياة ..
لماذا التخبط اصبح رفيق الكثير اليوم؟؟
لااجدهم يعيشون روعة معنى ( هدفي في هذه الحياة)؟؟؟
ربما ينقصنا الصمود من أجل تحقيق تلك الاهداف..

http://faculty.ksu.edu.sa/alwadani/Pictures%20Library/_w/%D8%A7%D9%84%D9%87%D8%AF%D9%81_jpg.jpg (http://faculty.ksu.edu.sa/alwadani/Pictures%20Library/%D8%A7%D9%84%D9%87%D8%AF%D9%81.jpg)

ترتيب الأهداف لابد منه..حتى نصل الى غايتنا المنشوده
سمعتها من دكتور في التنميه البشريه ( قال
ضع هذه الاسئله نصب عينيك ..وأجب عليها
فانها تساعدك في تحقيق هدفك
( ماذا اريد من هذه الحياة ؟؟
كيف احصل على ما أريد؟؟
متى احصل على ماأريد.؟؟

نعم فالاحلام والاهداف الشيئ الأهم في حياتنا..
فهي تبني مستقبلنا بناء صحيح.
وكما قيل...
الحلم هو الخيط الذي نحيك
به أجمل وأعظم قصص الحياة


ليجلس كل منا وليسئل نفسه..
ماهدفي من هذه الحياة ؟؟
واين وصلت في طريقي لهدفي؟؟
وهل جعلت من هدفي سببا لنصرة ديني وأمتي؟؟

لا يدرك المجد من لا يركب الخطرا.. .. ولا يـنال العـُلاَ مــن قـدَّم الحـذرا
ومـن أراد العــُلا صـفـوًا بـلا كَــدَرٍ.. .. قَضَى ولم يقضِ من إدراكه وَطَرا

أسطر اختلجت وجداني..
وانا أرتب أوراقي..

عمر بن عبد العزيز
خامس الخلفاء الراشدين يقول معبرا عن طموحه :

" إن لي نفسا تواقة ،
تمنت الإمارة فنالتها،وتمنت الخلافة فنالتها ،وأنا الآن أتوق
إلى الجنة وأرجو أن أنالها "

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قيل ان الذكريات
إنها تلك الخطوط الرفيعة الشفافة ،،
التي تخطها اللحظات والسنون ،
تترك بصمتها على صفحات أيامنا ،،
وتنعش خواطرنا ،،،،، كلما كان الذهن شاردا

http://3.bp.blogspot.com/-F8zrJchoqko/TVySLyw9gBI/AAAAAAAAAE4/-wL_23Ba2V0/s200/writers-block-1024x768.jpg (http://3.bp.blogspot.com/-F8zrJchoqko/TVySLyw9gBI/AAAAAAAAAE4/-wL_23Ba2V0/s1600/writers-block-1024x768.jpg)

دفتر صغير.. حوى بداخله..
امتزجت بين ألم وأمل
وحزن وفرح
ودمعات وضحكات
ذكريات فيها من البشرى والتنبيه..
لايخفى عن الكثير اليوم..
ماحصل من احداث .. لم نكن نتوقع حصولها يومآ..
احداث عرفها الصغير قبل الكبير..
وهنا سوف اختصر مامر به العالم..
من دفتر ذكرياتي..
ذكريات الثورات...والثروات..
http://ainnews.net/wp-*******/uploads/2011/01/news316.jpg (http://www.egy3rb.com/showthread.php?t=26887)

في ارض تونس تعالت الصيحات..
لتعلن كفى فقد سئمنا الظلمات..
منع حجاب ونقاب واذان يرفع للصلوات..
فنطلقت صرخات محت كل البغي والظلمات..
واليوم عاد النقاب والحجاب في الجامعات..

وفي ارض الكنانة.. تلاطمت امواج الأمس..
امام ناظري..
واعاد التأريخ نفسه..
فتذكرت قول الشافعي رحمه الله حينما سئل
نسأل الله ان يمكننا ام يبتيلنا
قال لن تتمكنوا حتى تبتلوا..
فمن البلاء .. خرجت عزيمة
لاخوف بعد اليوم..
وآن الآوان ان يرحل كل من ظلم..
حينها استشعرنا قول الله تعالى
( يعز من يشاء ويذل من يشاء)

وهناك من تلك الارض
التي صدحت بها مقولة ذلك الرجل المغوار
المجاهد عمر المختار
حينما قال/ نحن لن نستسلم ننتصر او نموت..
صبرتم كثيرا على حاكم
لا يكفي ان نسميه احمق.
وأقر الله أعينكم به
فلله الحمد والمنه..
وهنا صدق الشاعر اذ يقول..
وما من يد الا يد الله فوقها..
http://www8.0zz0.com/2011/12/03/15/145207173.jpg (http://www.3mri-qtr.com/vb)

وفي ليالي رمضان وعند مائدة الافطار
نسمع استغاثة اهل الشام
ان هلموا امة الاسلام..
فقد رأينا ابشع الظلام..
ممن يسمي نفسه بشار بل هو نشار
لاادري تلك الاستغاثات..
ادمعت المآقي..
وتذكرت حينها ارض العراق
http://www.ct-7ob.com/vb/imgcache/131074.png (http://www.klam-iq.com/vb)
تلك التي عانت ولازالت تعاني
من مذهب رافضي خوانِ
هذا ماحصل من ثورات في اراض عربيه اسلاميه..
ولكن هنا لنقف ولنقول أي ثروات خلفت
تلك الثورات..
اولا/ كسر وقتل ذلك القاتل ..
الذي حول حياة الكثير منا الى غابه موحشه
انه الخوف تجاوزنا ولله الحمد ذلك الجدار

ثانيا/ يبدوا ان شباب الأمة وعى وادرك
مايجب ان يسعى إليه..
ثالثا/ آن الآوان ان نضع بصمة في رقي امتنا..
ونصرة ديننا ..
وكثير هذه الثروات
وهذه من اهمها..
واجتمعت تلك الدول جميعا تحت راية

واجد من بين صفحات الذكريات..
عنوان عنونته ( بالتنبيهات)
فكتبت قائله..
حينما هبوا للتغيير
كانوا شجعان ... فغيروا الانظمه .. وقهروا ذلك
كله ليس بالاسلحه .
بإرادتهم .. .
عزمهم ..


نعم النفس تعطينا من الهمه بقدر مانحدد لها من الغرض

ولكن اخوة الايمان اخوات العقيده

اليوم نحن بأشد الحاجه الى ثورة من نوع اخر..

ثورة لو نجحنا بها لن يكون التغير فقط في مجتمعاتنا
بل سيكون التغير جذري تغير سنرقى به عاليا
تغير سنحيا به حياة رائعة جميله
اه مااحوجنا إلى هذه الثوره

إليكم عنوانها : ثورة الاستيقاظ قبل الرحيل
مطالبنا :
1_ اصلاح النفس
2_ إعادة امجاد المسلمين
3_قرأء الكتب يأمة اقرأ
4_عمل الخير في كل لحظه
5_عهد نأخذه على انفسنا بعدم اضاعة وقتنا
6_ الامر بالمعروف والنهي عن المنكر
7_ الدعوه الى الله اينما كنا
8_ بر الوالدين
9_ نصرة اخواننا المجاهدين في اي وقت واي وسيلة تتوافر ليدنا

" نعم هذه هي مطالبنا

وهذا هو شعارنا "


انها ثورة للتغيير نفوسنا

واعلموا انه من احبه الله استعمله في طاعته وجعله لايعيش لنفسه فقط .. بل يعيش لدينه
داعيا إليه امرا بالمعروف نهايا عن المنكر
مهتما بأمر المسلمين
ففي الشيشان اخته
وفي الافغان امه
وفي فلسطين ابنته
وفي العراق احبابه
يألم لألمهم ويفرح لفرحهم
اذا رأى المنكرات امتلأ قلبه حسرات
وفاضت عيناه بالدمعات":

الابطال حقا : هم الذين تعرض عليهم الشهوات وتتدافع عليهم المحرمات فيفرون الى الله منها وتغلب عليهم محبته وتحيط بهم قوته..

اذا فلنكن ابطالا ..

لان الابطال : ليس عندهم مجال للموازنه بين الدين والدنيا يختارون هذه تاره وتلك تاره الدين عندهم مقدم ابدا لايخشون لأجله احد
فلنأخذ عهدا على انفسنا ان نكون ابطالا
تبكي السماء لفقدنا
وتحزن الارض لفراقنا ولايزال الاسلام ينتظر امثالنا
الى هنا انتهت صفحات التنبيهات..

بقى صفحتين من ذكريات عام


صفحة قد رسمت عنوانها

بـ( حينما فقدوا الهويه ضاعت القضيه)

رأينا انتشار وامتداد تلك النيران

انها نيران إيران تلك التي تسعى ان تحرق

الاخضر واليابس..

( اهل السنة اليوم يعانون من فقد الهويه.. فحينما فقدت الهويه ضيعوا القضيه..
لااقصد هنا هوية كل منا .. تلك التي يقال عنها شهادة الميلاد..
كلا: الهويه هي ( الاتباع الحقيقي / لدين الاسلام)

اما آن الآوان ان نعرف أبنائنا عن مذهب الرافضه..؟؟
اما آن الآوان ان نعيد تفكيرنا ونجدد اهدافنا؟
اما آن الآوان ان نطفئ ونخمد تلك النار..؟؟
http://www.qa44.com/powerpoint/wp-*******/uploads/188%D9%85%D8%A7%D8%A1-224x300.jpg (http://www.qa44.com/powerpoint/wp-*******/uploads/188%D9%85%D8%A7%D8%A1.jpg)

بماء التوحيد الخالص.. والاتباع الحقيقي..
لن نستطيع ان نحرر العراق والاحواز وكل ارض يعانون اهل السنة\
من هذا المذهب الرافضي
الا الا بعدما نحقق كلمة الهويه..
فيحنها ننصر القضيه...
ولازال للكلام بقيه.."

واخر صفحة .. كان عنوانها

إرث لايمكن جمعه خسئتِ ياامريكا..

كتبت بها.. مايلي..

قال سيد قطب رحمه الله إن أصحاب الأقلام يستطيعون أن يصنعوا شيئاً كثيراً ، ولكن بشرط واحد : أن يموتوا هم لتعيش أفكارَهم من لحومِهم ودمائِهم .. أن يقولوا ما يعتقدون أنه حق ويُقدّموا دمائهم فداء لكلمة الحق ..
إن أفكارنا وكلماتنا تظلّ جثثاً هامدة ، حتى إذا متنا في سبيلها وغذّيناها بالدماء ، انتفضتْ حيّة ، وعاشت بين الأحياء

كلنا نرحل عن هذه الدنيا ويترك إرث
لااهله .. ولكن
صعب ان يرحل شخصا .. ويترك أرثا لكل الناس ..
وهذا لم اجده الا بذلك الاسد المغوار..
حقا كما قيل ..
إن العظماء يدخلون الدنيا كما يدخلها الناس ، ولكنهم يأبون أن يخرجوا منها كغيرهم

فخرج من هذه الدنيا وهو يترك إرث للملايين من الناس..

اعجز ماذا اقول .. فجف الحبر ياابا عبدالله
شعري واحرفي باتت خجلة .. كيف لها ان تصف أميرها
جزاك الله عنا وعن المسلمين خيرا
فأن قتلت فإرثك الذي تركته كثير وكبير على الامة اجمع
افكارك ستبقى نورا تضيئ لنا الطريق
خسئت ياامريكا فأن فرحت اليوم بمقتل هذا البطل
فاأمة االإسلام ولود لا تعقم أبداً
سيولد الف من ابا عبدالله .. ولكن صبرا..
فأن فرحت ِ ساعه ستحزني ساعات وسنين
إذا سيّدٌ منّا خلا قام سيّدٌ ... قؤوول لما قال الكرام فعولُ

وسنظل نقول الابطال يغيبون لكن لايموتون
وهنا اغلق دفتر ذكريات
http://img206.imageshack.us/img206/2030/187255874d6f25f67b1bwe3.jpg (http://img206.imageshack.us/img206/2030/187255874d6f25f67b1bwe3.jpg)

عام 2011 ..
املآ بصفحات مشرقه في عام 2012 ان شاءالله

لنردد ونقول..
سوف نبقى هنا كي يزول الالم
سوف نحيا هنا سوف يحلو النغم
رغم كيد العدا رغم كل النقم
سوف نسعى الى ان تعم النعم
سوف نرنو الى رفع كل الهمم
للمسير للعلا ومناجاة القمم
فلنقم كلنا للدواء والقلم
كلنا عطف على من يصارع السقم
ولنواصل المسير نحو غاية اهم
ونكون حقا خير امة بين الامم . http://www.safeshare.tv/w/GNPGvWnYkN

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

«•• اسألْ ربك على قدر ما تظنه فيه ••»

قال الله عز وجل:
{ قَالَ رَبِّ اغْفِرْ لِي وَهَبْ لِي مُلْكاً لَّا يَنبَغِي لِأَحَدٍ مِّنْ بَعْدِي إِنَّكَ أَنتَ الْوَهَّابُ}
(35) سورة ص.
إذا جئت تسأل الله فلا تسأل الله على قدر ما تظنه في الناس ولكن اسأل الله على قدر ما تظنه في ربك
الله جل وعلا أعظم مسئول
هذا سليمان يفقه هذه جيدًا فلما سأل ربه سأل ربه على قدر ما يعلمه عن ربه، لا ما قدر ما يستحقه
فنحن لا نستحق شيئا لكننا نسأل الله على قدر علمنا بعظمة ربنا وجلال قدرته وأن خزائنه لا تنفد سبحانه وتعالى.
فهذا النبي الصالح قال {رَبِّ اغْفِرْ لِي وَهَبْ لِي مُلْكًا لَّا يَنبَغِي لِأَحَدٍ مِّنْ بَعْدِي إِنَّكَ أَنتَ الْوَهَّابُ}
فمنّ الله جل وعلا عليه وأعطاه ما سأل
{فَسَخَّرْنَا لَهُ الرِّيحَ تَجْرِي بِأَمْرِهِ رُخَاء حَيْثُ أَصَابَ} (36) سورة ص ،
حتى أصبح في الأمثال يقال ملك سليمان كناية عن الملك العظيم الذي لا يعطى لأي أحد وهذا فضل من الله جل وعلا له.

تأملات قرآنية
للشيخ صالح المغامسي - يحفظه الله -

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سبحان الله .... وانا ايضا كنت منشغل بوالدة زميلي وصديقي انتظرناها لتركب في الحافلة من وكالة السياحة ولم اشارك سوى الصباح .......
ولكن انت افضل مني فقد طلبت منها الدعاء لأحباب منتدى الجلفة أما انا فطلبت منها تخصيص دعوة لي فقط ....

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

------ [ السّلامُ عليْكُم ] -----


بقول الله تعالى :
" وَمَا خَلَقْتُ الْجِنَّ وَالْإِنْسَ إِلَّا لِيَعْبُدُونِ "


ويقول سبحانهُ في مُحكمِ تنْزيله :
" اعْلَمُوا أَنَّمَا الْحَيَاةُ الدُّنْيَا لَعِبٌ وَلَهْوٌ وَزِينَةٌ وَتَفَاخُرٌ بَيْنَكُمْ وَتَكَاثُرٌ فِي الْأَمْوَالِ وَالْأَوْلَادِ
كَمَثَلِ غَيْثٍ أَعْجَبَ الْكُفَّارَ نَبَاتُهُ ثُمَّ يَهِيجُ فَتَرَاهُ مُصْفَرًّا ثُمَّ يَكُونُ حُطَامًا وَفِي الْآخِرَةِ عَذَابٌ
شَدِيدٌ وَمَغْفِرَةٌ مِّنَ اللَّهِ وَرِضْوَانٌ وَمَا الْحَيَاةُ الدُّنْيَا إِلَّا مَتَاعُ الْغُرُورِ "


إنّها الدّنْيا وحُطامها الفاني ...
واغْتنامُ الحياةِ فيها قبْلَ الممات
والعَمل فيها قبْل الفوات فمَا هيَ إلّا رحْلةٌ لعبادِ الله
رحْلةٌ لدارِ القَرار ... والرّحلةُ تحْتاجُ زاد ... زادٌ كثيرٌ ليَكْفي رحْلة الحساب
لهذا ما جُعلت الدّنْيا إلّا لكسْب الحسنات فيهَا وجَمْع الزّاد

ولو تأملّنا حياةَ المُسْلمِ فيهَا ...

لماذَا وَجدْنا ...؟!

لوجدنَاهَا حياة يَقْظةٍ دائمة وربْحُها مستمّر
يَوْمها خيْرٌ من أمْسهَا ... وغَدُها خيرٌ من يوْمهَا


ولأنّها حياةُ المُصْطفين الأخْيار ...
عبادُ الله الأبْرار ... ما رأيْناهُم ينامونَ ولا يَلْعبون
بل يُسبّحونَ ويذْكرونَ ويَسْتغفرونَ الله باللّيلِ والنّهار

ولأنّها حياةُ رسولنا الحبيب ...
فقد كانَ يَقِظَ القلبِ والعَقْل تنامُ عينهُ
وقلبهُ لا ينام وهُوَ الذي غُفرَ له ما تقدّم منْ ذنبهِ وما تأخر


ولأنها حياةُ أهْل الجنّة ...
فالجنّةُ تسْتحقّ البَذْلَ والعَطاء والكَثير منَ التّضْحية
فلا نَومٌ فيها ولا ممات ... دارُ المُقام الأمين ...

ولأنّها حياةُ التّكليف ...
والجدّ والعَمل والاجْتهاد يقولً الله تعالى :
" فَمَنْ يَعْمَلْ مِثْقَالَ ذَرَّةٍ خَيْرًا يَرَهُ * وَمَنْ يَعْمَلْ مِثْقَالَ ذَرَّةٍ شَرًّا يَرَهُ "


ولأنّها حياةُ الغَنيمة لمَن اغْتنمها ...
وفُرصة لمَن كسبَها ... واهْلُ هذه الحياةِ قلّة
لأنّهم آمنوا بالله وعملوا الصّالحات وتجنّبوا المُهْلكات

واهْل الإيمانِ قليل ...
وقلّة لأنّهم شكروا الله تعَالى بجوارحهم
وقلوبِهم وألْسنَتُهم ... لمَا وهبهم الله إيّاهُم من نِعَم

وأهْلُ الشّكر قليل ...
يقولُ الله تعالى :
" وَقَليلٌ مِن عِباديَ الشَّكُور "


وقلّة لأنّهم غُرباء ...
كالشّعرةِ البيْضَاء في الثّور الأسْود
أو كالشّعرة السّوْداء في الثّور الأبْيض
غُرباء ... لأنّهم الثابتونَ في زَمن الفتن المُصْلحونَ لمفاسد النّاس
والذينَ يَصْلحونَ عنْدما يَفْسَدُ النّاس ...

غُرباء لأنّهم قلّة مؤمنة ...
طائعة لله بينَ جَمْعٍ يَعْصونَ الله
ويَتوبونَ في زمنٍ ضاعت فيهِ الحُقوق وتأنيبُ الضّمير للنّفْس
الأمّارة بالسّوء ...

هُم قلّة ...
لأنّهم ذاقوا حلاوة الإيمان
وعَلموا المُرادَ من خلْقهم بطاعة الله وأوامره واجْتنابِ نواهيه
ومكارهه ... فتَراهم يَصْفحونَ ويُسامحونَ ويكْظمونَ الغَيظَ ويعْفون
ليكونوا منَ المُحْسنين ...‘

فقد علموا أنّ الله ناظرٌ لهم ...
وانّ جوارحُهم شاهدة عليْهم ... فخافوا الله سرّاً وعَلناً
وجَمعوا خيْرَ الزّادِ وحفظوا الله تعالى ليَحْفظهم يومَ تشْخصُ فيه الأبْصار

فتركوا الدّنْيا وملذّاتها ...
فجمعَ الله لهُم شَملهم ... وجعلَ غناهُم في قلوبهم
وأتتهُم الدّنْيا وهيَ راغمة ... فرزَقَهُم من حيثُ لا يحْتسبون

إنّها حياةُ / الغُرباء /
[ فطُوبَى للغُرباء ...)

وعَذبُ التّحَاياَ لكُم
بقلمـِ أختكنّ : مَن تسألُ المَولَى لغروبٍ لهَا هُوَ النّدَى
نَديّة الغُرُوب

--- [ في أمَان الله ] -----

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

الاخ ساجد الى الله لو تفضلت وتكرمت ان تنقص من حجم الصور التي تضعا فهي تثقل تصفح الموضوع او قلل من وضع الصور والجميع يعاني من ثقل تصفح المنتدى .... دمت طيب

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

الآآآن قــــفــ ..!!!!
http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc3/16749_370062715293_318814280293_10117672_3390749_n .jpg

{ صلِ على النبي المصطفـــــــــى }


والآن قم بالإستغفــآآر الــى مــآآشااء الله


|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

فعلا سبحان الله
ما عليش كي تدعي و ربي يستجيب لها راها زايدة فينا....
المهم قول لصديقك كي يحكي مع امو يقوللها تدعيلنا و يتحل المشكل ....

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

شكراا اخت بيرلآ راكي توصي علينا..

ربي يرزقك ما تتمناي..
وان شااء الله الحج المبرور
و يرزقك اعالي الجنان والرضوان

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

اخي هي كي ولات رايحة قالتلنا كل واحد وش يحوس نجيبلوا معايا حاجة انا قلتلها ادعيلي ربي كي تولي عند الكعبة و ادعي لكل احبابي الي نعرفهم وحسبتهملها بالاسم و ذكرت احبابي في المنتدى ...
اللهم آمين يارب لنا ولجميع المسلمين والمسلمات

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آآجماعة ما معنى الظاهرية لم افهم شيئا..!!!!

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

اخي انا ايضا لم افهم

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قرأت موضوع [هذه سلفيتي]

تقريب لم افهم شيء [اللغة العربية التي يتكلمون بهآ قوية جداا..] ترىما السبيل التي توصل الى ذلك ؟؟

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

اخي هل تقصد السبيل التي توصلك لآن تكون لغتك العربية قوية؟؟؟
اولا انت ما زلت صغيرا ومع الوقت ستكتسب مهارات لغوية و مصطلحات جديدة يوم بعد يوم......
و ثانيا عليك بالمطالعة من الكتب و ليس من الانترنت فهي جد مفيدة لكسب لغة جيدة...

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
نعم ذلك هو
ان شااء الله

آه كنت اظن اظن انني سأكتسب من الانترنت ...
إذن الكتب,, أي كتب يمكنك ان تنصحيني بهآ ؟ إن لم يكن لديك مانع

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

السلام عليكم ورحمة الله تعالى وبركاته
صباحكم سعيد و ايامكم اسعد
يبدو ان اهل الدار خاجها اليوم او ربما انتم مشغولين بأمور اخرى فقط نرجو ان لا تطيلوا الغياب علينا ...
فالدار بلا بيكم سامطة

اخي اقرأ ما يوافق مستواك الفكري و قدرة عقلك على الاستيعاب ...فأنت مازلت صغير و لا يجب ان يلهيك هذا عن دراستك ...
اولا القرآن العظيم فيه من الكنوز اللغوية ما الله به عليم اقرأه بتمعن و هدوء وستتعلم منه الكثير عن اللغة...
و اقرأ كتب التفاسير الميسرة ....
تغيب عني العنواين ولكني سأبحث لك عن ما سيفيدك

السْسَلآَمُ عَلَيْكُمْ ، صَبَآحُ الخَيْرْ لِجَمِيييع أَهْلِ الدَّآرْ

عَلِمْتُ انَّ عِطْرَ المَلِكَة تَعشقُ القِطَطْ ، فأَتَيْتُهآ بهديَّتَيْنْ :)



قال إبن القيم رحمه الله :

حال العبد في القبر كـ حال القلب في الصدر ..!

{ نعيماً ، وعذاباً ، وسجناً ، وإنطلاقاً }

فــ إذا أردت أن تعرف حالك في قبرك ..

فــ انظر إلى حال قلبك في صدرك ..

اللهم أصلح لنا قلوبنا ,, ويسر لنا أمرنا

وأهدنا الى طاعتك {♥}

https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/431556_227601513999437_100002487701654_514490_1243 989837_n.jpg

و عليكم السلام و الرحمة و الاكرام
يسعد صباحك
بالرغم انه لم يكن لدي اي رغبة في كتابة اي رد
لكن لما رأيت الهدية الجميلة لم اتردد في ان اشكرك خالص شكري و امتناني
عجبني هذ القط
شكله ذواق و له اذن موسيقية

و هذ القط شكله يريد النوم فكرني بحالي في هذه الايام الباردة
و الله هدية حلوة من اخت كلها ذوووووق و رقي
احبك في الله دمتب بود

سلام عليكم
نتاعش هذا الموضوع ؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟؟

إقرأ هذه القصة :

لما رجع عمر بن الخطاب رضي الله عنه من الشام إلى المدينة المنورة إنفرد إلى الناس ليتعرف أخبار رعيته ، فمر بعجوز في خبائها فقصدها ، فقالت : يا هذا ، ما فعل عمر ؟
قال : قد أقبل من الشام سالما.
فقالت : لا جزاه الله عني خيرا.
قال : ولم ؟!
قالت : لأنه والله ما نالني من عطائه منذ ولي أمر المؤمنين دينارا ولا درهما.
فقال : وما يدري عمر بحالك وأنت في هذا الموضع ؟!
فقالت : سبحان الله ! والله ما ظننت أن أحدا يلي أمر الناس ولا يدري ما بين مشرقها ومغربها.
فبكى عمر رضي الله عنه ، وقال "في سره" : واعمراه ! كل أحد أفقه منك يا عمر !
ثم قال لها : يا أمة الله ، بكم تبعيني ظلامتك من عمر ، فإني أرحمه من النار ؟
فقالت : أتهزأ بنا يرحمك الله !
فقال : لست بهزاء ، فلم يزل بها حتى اشترى ظلامتها بخمسة وعشرين دينارا.
فبينما هو كذلك إذ أقبل علي بن أبي طالب وإبن مسعود رضي الله عنهما ، فقالا : السلام عليك يا أمير المؤمنين.
فوضعت المرأة يدها على رأسها وقالت : واسوأتاه ، شتمت أمير المؤمنين في وجهه !
فقال لها عمر رضي الله عنه : لا بأس عليك رحمك الله.
ثم طلب رقعة يكتب فيها فلم يجد ، فقطع قطعة من مرقعته وكتب فيها :
"بسم الله الرحمن الرحيم ، هذا ما اشترى عمر من فلانة ظلامتها منذ ولي إلى يوم كذا وكذا بخمسة وعشرين دينارا ، فما تدعي عند وقوفها في المحشر بين يدي الله تعالى فعمر منه بريء ، شهد على ذلك علي بن أبي طالب وابن مسعود رضي الله عنهما"

( الدميري : مجلد 1 ، ص 73 )

بسم الله ما شاء الله ..
بسم الله ما شاء الله ..
بسم الله ما شاء الله ..

أسعد الله صباح الجميع ..
مع أننا نقترب من المساء .. :cool:

لكن لآ أدري حقا من أين أبدأ .. و من سأجيب ..
و كيف أفعل .. :1:

يعطيكم الصحّة ..

سأحآول ان أبرّر غيابي .. :rolleyes:

غبتُ عنكم و عن دارنآ لأسباب ..
قد أحصر اغلبها و أقهرها فيما يلي ..

لم أستطع ولوج الدار .. و ان حدث ونجحتُ في الدخول
أحسّ المتصفّح ثقيلا جدّآ .. ثقلا لم أعرفه من قبل :mad:

و لا يمكنني كتابة رد ..

لا ادري ان كان الأمر يحدث لكم أم لا !!!!!

حاولتُ مرارا و تكرارا .. لكن في هذا الموضوع بالذات لا اعلم ما حدث .. :confused::confused::confused:

ثمّ أظنّ أنّ هذا ما سبّب لي بعضا من القلق و النرفزة .. :1:

فسجلتُ الخروج يائسة أن أراكم مجدّدآ ..


أردتُ أن أجيب كلّ واحد على حدى ..
لكن الله غالب .. بالكاد استطعتُ كتابة هذه الكلمات ..
من متصفّح [ موزيلا ] ..
و بيني و بينكم أكرهه .. و لا أحبّ استعماله ..

والفت الإكسبلورر .. لكن كلما فتحته يتبلوكآ ..

هل أجد حلآ عندكم يا ترى ؟؟

و هل منكم من يعاني من ولوج الدار مثلي ؟

أظن راه فيها الغاشي الله يبارك .. :1:
لذلك ما صاحتليش بلاصة معاكم .. :)

على العموم الله يبارك فيما تقدّمونه و ما تطرحونه
و شكرا لكم جميعا بما فيكم الضيوف الجدد الذين حلوا علينا

نقولولهم الدار داركم و مرحبا بالجميع .. :mh31:

لا يكفيكم ثنائي يا من شاركتمونا بالفوائد ..

أسأل الله أن يجزيكم كلّ خير ..


مجيد حـ
2012-02-08, 11:29
ههههه هذا ولى موضوع للاقتباسات الطويلة ههه

معاً إلى الله
2012-02-08, 11:39
ههههه هذا ولى موضوع للاقتباسات الطويلة ههه

لا أبدآ .. :1:
كانت حالة استثنائية .. للأسباب المذكورة أعلآه ..
اقتبست كلّ الردود مرّة واحدة ..

ان شاء الله سنكون معكم حاضرين ..

مرحبآ بكم أخي الكريم حميد .. نوّرتم الدآر العزيزة ..
أظنّ أنكم فهمتم الفكرة ..

الدىر دآركم فتعال معنآ تفيد و تستفيد ..
و ننال الأجر معا ان شاء الله ..

لا تنسى الدآر دآركم .. فأهلا بكم في كلّ وقت ..
و نحن ننتظر بما ستفيدنا أو ان أردت المناقشة في ايّ مجال فلتتفضّل مشكور ..

طآب يوم الجميع ..


سآجدْ للهْ
2012-02-08, 11:47
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

السلام عليكم

صباح الإيمان والقرآن


اختي معاً الى الله استخدمي فايرفوكس افضل بكثير من الاكسبلور انا ايضا كنت مثلك ولكن [يتبلوكا هذه الحاجة السيئة فيه] درت فايرفوكس موزيلا ومع الوقت والفتو

يمكنك ان تحمليه من هنــآآ :
Version NameReleased DateSize

firefox 11.0 beta 1

02 February, 2012 (6 days ago) 15.99 MB

الرابط مباشر من هنا (http://download.oldapps.com/Firefox/Firefox%20Setup%2011.0b1.exe)

: هذه نسخة عندها 6 ايام من الاصدار نسخة ربي يبارك

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

مجيد حـ
2012-02-08, 11:48
مجيد ما نيش حميد

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-08, 11:51
أَسْعَد الله صَبآحكِـ أُخْتِي معًآ ..

Firefox أَحْسَنْ ,, اسْتعمِلِيه و سَتُلآحظِين الفَرْقْ :19:

معاً إلى الله
2012-02-08, 12:04
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

السلام عليكم

صباح الإيمان والقرآن


اختي معاً الى الله استخدمي فايرفوكس افضل بكثير من الاكسبلور انا ايضا كنت مثلك ولكن [يتبلوكا هذه الحاجة السيئة فيه] درت فايرفوكس موزيلا ومع الوقت والفتو

يمكنك ان تحمليه من هنــآآ :
Version NameReleased DateSize

firefox 11.0 beta 1

02 February, 2012 (6 days ago) 15.99 MB

الرابط مباشر من هنا (http://download.oldapps.com/Firefox/Firefox%20Setup%2011.0b1.exe)

: هذه نسخة عندها 6 ايام من الاصدار نسخة ربي يبارك

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

و عليكم السلام و رحمة الله و بركاته ..
مرحبا أخي الكريم عقبة ..

جآري التحميل .. :)

بارك الله فيك و حين أستعمله سأخبرك بالنتيجة .. :mh31:
ربي يعطيك ما تتمنى ..

مجيد ما نيش حميد

آآه .. معذرة .. لا أدري كيف قرأتهآ حميد .. :1:
أعتذر سيدي الكريم ..
و ننتظر مشاركاتك القيّمة ..


أَسْعَد الله صَبآحكِـ أُخْتِي معًآ ..

Firefox أَحْسَنْ ,, اسْتعمِلِيه و سَتُلآحظِين الفَرْقْ :19:

و صباحك أسعد أختي الكريمة ..
جاري التحميل .. سأخبركم بالفرق ..

فقد شاب راسي مع الاكسبلورر .. :mad:
و لولا ثقله .. ما تأخّرت عنكم .. لكن قدّر الله و ما شاء فعل ..


معاً إلى الله
2012-02-08, 12:11
لكلّ محبي العطور ..

فواحات عطرية بجميع الاشكال

سآجدْ للهْ
2012-02-08, 12:12
و عليكم السلام و رحمة الله و بركاته ..
مرحبا أخي الكريم عقبة ..

جآري التحميل .. :)

بارك الله فيك و حين أستعمله سأخبرك بالنتيجة .. :mh31:
ربي يعطيك ما تتمنى ..

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
اهلااا جوزي جوزي الدار دارك


ان شااء الله تكون نتيجة مليحة

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

معاً إلى الله
2012-02-08, 12:15
بسم الله الرحمن الرحيم

هل فكرتِ في تعطير حمامك بعطر يدوم لأيام ، مع عمل شكل جمالي يضفي على المكان جمالاً ورونقا ؟!

إليك طريقة جميلة جداً وسهله ويمكنك عملها في دقائق ..


- كأس زجاجي أو فازة زجاجية أو وعاء زجاجي ، المهم أن يكون زجاجياً .

- أصداف .

- زيت عطري ويمكن أن تستعملي أي نوع من أنواع الزيوت العطرية .. مثلا زيت برائحة الياسمين .. فلك أن تختاري ما تفضلين .

طريقة العمل

- ضعي الأصداف في الزجاجة ثم صبي فوقها الماء .. ثم ضعي بضع قطرات من الزيت العطري ، واتركيها على حوض المغسلة ، واستمتعي بالرائحة الفواحة التي تدوم تقريباً 3 أيام .

- ويمكن تحريك الزجاجة كل فترة من أجل أن تنتشر الرائحة من جديد .. أو تسكبين بعض الماء الساخن عليها .

إضافة من أجل منظر أجمل

- يمكن تلوين الماء حسب لون ديكور حمامك (أخضر .. أزرق .. إلخ ) .

- ويمكن إضافة بعض الصخور البحرية الصغيرة الزجاجية الملونة مع الأصداف ، وهنا أيضا تختارين اللون حسب لون "ديكور" الحمام .

معاً إلى الله
2012-02-08, 12:19
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
اهلااا جوزي جوزي الدار دارك


ان شااء الله تكون نتيجة مليحة

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

الله يزيد فضلك أخي الكريم ..
ان شاء الله تكون النتيجة أحسن ..
راه قريب .. راه 75 %

ربي يحفظك .. :mh31:

معاً إلى الله
2012-02-08, 12:46

الألوان ، هي من أهم الأشياء في التصميم وهي ما يمكن أن تشكل فرقاً بين التصميم الجيد والتصميم السيئ ، وبين التصميم الجميل والتصميم القبيح .

وبدون الاستعمال الجيد للألوان ، تصميمك لن يؤثر عليك كما كنت تتوقع .

الألوان الدافئة والألوان الباردة

في العادة الألوان الدافئة والباردة صعبة الفهم ، لذا فاتبع هذا الدليل لكي لا تصادفك أي مشكلة مستقبلاً .

الألوان الدافئة :

الألوان مثل الاحمر، البرتقالي، الاصفر تعتبر من الألوان الدافئة .
وبالتحديد ، ممكن ان نقول بأن الألوان الدافئة هي الألوان التي نراها عادةً في النار .
الألوان الدافئة تستعمل عادةً لإظهار الإبتهاج .
الشعارات والصور التي تستعمل العديد من الألوان الدافئة تستعمل لتوصيل الغضب ، الكره ، الحقد .


الألوان الباردة:

الألوان مثل الاخضر، الازرق، البنفسجي تعتبر من الالوان الباردة .
وبالتحديد ، ممكن ان نقول بأن الألوان الباردة هي الألوان التي نراها عادةً في الطبيعة (الماء ، النباتات ، الخ) .
الألوان الباردة تستعمل عادةً لإظهار الهدوء ، النشاطات الهادئة .
تستعمل المستشفيات اللون الازرق المخضر ، مدموجان مع بعضهما البعض على الجدران ، وذلك لإبقاء المرضى بأعلى درجة من الهدوء .


الألوان الرئيسية :

ماهي الألوان الرئيسية ؟ في الحقيقة إنها ثلاثة الوان والتي ممكن ان تستعمل لصنع كل الألوان الأخرى التي عرفها الإنسان .
الاحمر و الازرق والاصفر ، هي الالوان الرئيسية .
عندما يمزج الاحمربـ الاصفر ، تحصل على البرتقالي .
وعندما يمزج الازرق بالـالاصفر ، تحصل على الاخضر . وعندما يمزج الاحمر بالـ الازرق ، تحصل على البنفسجي .
تستعمل الألوان الرئيسية بكثرة في مطاعم الوجبات السريعة .
معظم شعارات مطاعم الوجبات السريعة تستعمل الازرق ، الاحمر ، الاصفر لإقناع الزبون بسرعتهم .
كما انهم يجملون مداخل مطاعمهم بالألوان الأساسية لكي يمنعوا الزوار من البقاء .
يريدون الزائر أن يأتي ويطلب الطعام ، ويأكله بسرعة ، ثم يذهب .


الألوان الفرعية
ماهي الألوان الفرعية ؟
الألوان الفرعية هي الألوان التي تحصل عليها عندما يتم دمج لونين من الألوان الأساسية بقيّم متساوية .
البرتقالي ، و الاخضر ، و البنفسجي تعتبر من الألوان الفرعية .


الألوان المتقابلة :

ماهي الألوان المتقابلة ؟ في الحقيقة ، إنهم ببساطة الألوان الموجودة على الطرف الآخر من عجلة الألوان (انظر لعجلة الألوان في الاعلى).
كما تلاحظ في عجلة الإطارات بالأعلى ، وبتطبيق قاعدة الألوان المتقابلة ، فإن الازرق متناسق مع البرتقالي ، الاحمرو متنساق مع الاخضر ، و الاصفر متناسق مع البنفسجي .


الألوان النصفية:

الألوان النصفية ماهي إلا الألوان الموجودة بين لونين في عجلة الألوان . الألوان مثل البرتقالي المحمر و الاصفر المخضر تعتبر من الألوان النصفية .
إذن ماهو الإختيار المناسب؟

إذا كنت تحاول أن تختار لون معين لكي يتناسب مع لون اخر ، فالأمر بسيط جداً ، إليك هذه القاعدة البسيطة : كل لون يتناسق مع مجموعته .
تتناسق الألوان الدافئة مع الألوان الدافئة الاخرى ، وتتناسق الألوان الباردة مع الألوان الباردة الاخرى .
كما يمكنك وبكل بساطة ، اختيار اي لون من عجلة الألوان ، ثم استعمل اللون الموجود بجانبه ، سوف تلاحظ أنهم متناسقين .
فالازرق يتناسق تناسق جميل مع الاخضر .

سآجدْ للهْ
2012-02-08, 13:08
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
القارورة المجروحة


لا تبكي على كأس انكسر ,,,, ولا تيأس على قلب من حجر ,,,, ولا تشفع لمن خان وغدر ,

لان كل شيئ شر عند البشر فهو حكمة عند رب البشر



حروفي اليوم اخطها إليها

ولاادري هل ستفي .. تلك الحروف مااريد

وهل ستخفف ذاك الجرح

حينما وصفها الرسول صلى الله عليه وسلم :

بتلك القاروره


فقال صلى الله عليه وسلم:

رويدا يا أنجشة ! لا تكسر القوارير " يعني ضعفة النساء


نعم انها تلك القاروة

المرأة عموما

التي جرحت ... جرح مؤلم


رسالة اخطها بدمع عيني ... الى

تلك الانسانه التي لقبت بــ ( المطلقه)

ليست لكل من حملت هذا اللقب


بل فقط للتي خرجت مظلومة من ذاك البيت

وادت في نفس الوقت حق الزوج على اتم وجه

ولكن قوبل ذلك بالنكران

نعم ربما يكون طرحي غريب

ولكن هي خلجات استوطنت الوجدان

فترجمها القلم ...

حينما طلقت قالت

( انتهت الحياة)

وقالت اغلقت جميع الابواب امامي ..

وكثر اللوم عليها ... واكثرت هي كلمة ( لو )


ولكن من فكرت

ان تخرج من هذا اللقب ( الطلاق وتجعل منه الانطلاق)

الانطلاق الى اين :

نعم الى روضة الفضلاء

ونزهة العقلاء


انها حديقة العلم

http://sfiles.d1g.com/photos/20/22/3832220_normal.jpg (http://sfiles.d1g.com/photos/20/22/3832220_max.jpg)

قال وهيب بن منيه : وهو يصف العلم من تعلم علما في حق وسنه لم يذهب الله بعقله


.. اعلم انكِ تألمت بل وبكيتِ

ولكن احمدي الباري .. انكِ خرجت مظلومه لاظالمه

خرجتِ وانتِ بقمة الاخلاق التي كانت يجب ان تتخلق بها تلك القتاة المسلمه

تلك التي عكست تربية اهلها في ذاك البيت ... الذي وإن هو لم يقدره

الان الله لايضيع من عمل صالحا



الم يقل المصطفى ( صلى الله عليه وسلم)

عجباً لأمر المؤمن إن أمره كله له خيرٌ، وليس ذلك لأحدٍ إلا للمؤمن: إن أصابته سراء شكر فكان خيراً له، وإن أصابته ضراء صبر فكان خيراً له".

.. نعم قال طيب القلوب رحمه الله ..

اين القيم..

من خلقه الله للجنه لازالت هداياه تأتيه من المكروه


دعيني اترجم سطوري هذه بـــــــــ


http://www.made-in-china.com/image/2f0j00urTQpGagdtBlM/Air-Envelope.jpg (http://www.made-in-china.com/image/2f0j00urTQpGagdtBlM/Air-Envelope.jpg)

ثلاثة رسائل :

الأولــــــــــــــــــــــــــى إليكِ انتِ ( ياصاحبة الانطلاقه)

حبيتي وأخيتي الغاليه : المؤمن لايحزن لفوات الدنيا ولايهتم بها لانها زائله وذاهبه

بعد التعب راحه .. وبعد الخوف أمن .. وبعد الليل فجر ساطع

حتى الحزن يجب ان نجعل منه شيئ يدفع ولا يقطع فيكون بذلك ايجابي ..

اعلمي بقدر همتكِ ومثابرتكِ يكتب تاريخكِ والمجد لايعطى جزافا وإنما يؤخذ بجدارة وينال

بالمثابره .. فأستفيدي وحلقي بالتقرب الى الله وطلب العلم وستجدين لذة مابعدها لذة وأنس

فإنطلقي ثبتكِ الله وعوضكِ خيرا..


الرسالة الثانيه للاأهل :( رفقا بها )

ارجوكم مهلا بها .. فلا ذنب لها سوى انها ارادت ان تكون المرأه المثاليه

في زمن لاتوجد به المثاليه .. كفى لوما .. كفى عتابا بل قولو ( قدر الله وماشاء فعل )

وكل قضاء الله يقضيه هو خير وحكمه اعلموا ان هناك فتحا مبينا

وفرجا بعد شده ويسرا بعد عسر ..


الرسالة الثالثه ( الى مجتمعنا )

رفقا بها .. لاتسيؤا الظن ..

فكما ان في السجون مظلومين فهناك ايضا في تلك البيوت يوجد المظلومين

فكونوا منصفين ...



فياصاحبة الانطلاقه ( سيري في انطلاقة جديده في رحاب العلم وحلقي في عالم الكتب الجميل فأنتي بالله قويه وحطمي قيود اليأس)


الايمان يغير مسار حياتنا .. والايمان يفتح لنا طرقا

مع الدعاء الذي يحقق المعجزات مع الدعاء الذي يسعفنا كلما عجزنا ان حياة ما نتمنى

الدعاء يعلمنا ان كل شيئ ممكن اذا انطلق من اعماقنا..

عن أبي هريرة - رضي الله عنه - قال : قال النبي - صلى الله عليه وسلم - : يقول الله تعالى : ( أنا عند ظن عبدي بي ، وأنا معه إذا ذكرني ، فإن ذكرني في نفسه ذكرته في نفسي ، وإن ذكرني في ملإ ذكرته في ملإ خير منهم ، وإن تقرب إلي بشبر تقربت إليه ذراعا ، وإن تقرب إلي ذراعا تقربت إليه باعا ، وإن أتاني يمشي أتيته هرولة ) .

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-08, 13:12
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
بسم الله الرحمن الرحيم
الحمدلله والصلاة والسلام على رسول الله وعلى آله وصحبه أجمعين
السلام عليكم ورحمة الله وبركاته

برنامج( مواقف من حياة رسول الله صلى الله عليه وسلم )

من إصدارات(موقع نصرة رسول الله صلى الله عليه و سلم (http://montada.rasoulallah.net/))
جزاهم الله خير الجزاء

طريقة تشغيل البرنامج

بعد تحميل أجزاء البرنامج ظلل كل الاجزاء و اضغط يمين عليها ثم يتم اختيار فك الضغط ،

بعد ذلك سيظهر مجلد و احد فقط بداخلة ايقونة autorun.exe منها يتم تشغيل البرنامج

بعض صور البرنامج





لتحميل البرنامج

الجزء الأول (http://media.rasoulallah.net/Maktaba/ar/Software/The_Life_Of_The_Prophet_Mohamed.part1.rar)

الجزء الثاني (http://media.rasoulallah.net/Maktaba/ar/Software/The_Life_Of_The_Prophet_Mohamed.part2.rar)

الجزء الثالث (http://media.rasoulallah.net/Maktaba/ar/Software/The_Life_Of_The_Prophet_Mohamed.part3.rar)

الجزء الرابع (http://media.rasoulallah.net/Maktaba/ar/Software/The_Life_Of_The_Prophet_Mohamed.part4.rar)

الجزء الخامس (http://media.rasoulallah.net/Maktaba/ar/Software/The_Life_Of_The_Prophet_Mohamed.part5.rar)

الجزء السادس (http://media.rasoulallah.net/Maktaba/ar/Software/The_Life_Of_The_Prophet_Mohamed.part6.rar)

اسال الله أن يتقبل هذا العمل

فى حفظ الله ورعايته

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-08, 13:29

بَآرَكـ الله فِيكِ أُخْتِي مَعآً الى الله على المَعْلُومآتْ ، كمْ أُحبّ الأَلْوآنْ !

أَحْضَرتُ العَدِيدْ من مَجْموعآت الأَلْوآن المُتنآسِقَة ، سَتُسَآهِمْ فِي التَّصمِيم الجيد لمُحتوى المَنْزِلْ


http://t0.gstatic.com/images?q=tbn:ANd9GcQYCqXs7DS5fMmYFhTjLZVU27p9sb21m uTqUQS4tN-VpzEyToCUMeOWIooV




http://t1.gstatic.com/images?q=tbn:ANd9GcSehaSHG17KHHN8zwDNlbaa00DA3e5Bo t1WbQIULKX4HsjF2FR5RjFYEjDTjg

سآجدْ للهْ
2012-02-08, 13:34
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

قال ابنُ مسعـودٍ رضى اللهُ عنه ”
عليك بطريق الصالحين
، ولا يغرك قِلَّةُالسَّالكين ..
واحـذر طريقَ الضَّلال ، ولا يغرك كثرةُالهالكين

كل منا حينما يستمع لشيئ ما.. او يرى منظر او موقف..
يتحرك في داخله ذاك الخيال الذي يطلق العنان للقلم ..
ماأحمل اليوم في جعبتي هي:
( محاضرات سمعتها لثلاثين يوما.. فخرجت منها بفائدة)
عنونتها بــــ ( الكهف المضيئ)..


هو كهف هجره الكثير منا..
او ربما لم يعرفوه اصلا..
نحن اليوم نعيش في حياة كل يوم ..
تكثر فتنها..
في كل مكان نرى معصيه .. او مخالفة شرعيه
انظر هنا انظر هناك
ارى العجب العجاب..
نعم لااستطيع ان اصمت اكثر
صرنا نرى المنكر وللااسف الكثير يغيره بقلبه ويردد ليقول:

(ذلك اضعف الايمان)

الجميع ينشد التجديد ولكن القليل سعى إليه
الجميع يريد حسن الخاتمه لكن القليل عمل لها
الجميع يفخر بالاسلام لكن القليل سعى ليقيم الاسلام في نفسه..

لااكتب هنا كلمات تحبط همما ولكنها حقيقة نعيشها نحن ..


نعم كتبت في الاعلى حالنا ولكن ..

نحن نريد حلا ...
الحل موجود بين ايدينا ..
كلنا سمعنا وقرأنا عن فتية الكهف .. في القران الكريم
ولكن : السؤال الذي اختلج الوجدان
نحن الان في زمن فتن كثيره ومدمرة حقا
هل فكرنا ان نأوي الى كهف يعصمنا منها؟؟
هذا مااريد ان اصل إليه ..
نعم ربما لم تخطر هذه الفكرة على شخص
لا لشيئ ولكن يبدو الامر مستحيل..
فهل يعقل ان نعيش في كهف ونترك بيوتنا ؟؟
اعمالنا وووو...؟؟؟
كلا لن يحصل هذا ..
ولكن نحن هنا اليوم لنبني كهف داخل انفسنا
مكتوب عليه( الاعتزال المعنوي )
عنوان غامض نعم ولكن ..
طلبي هنا .. ان تقرأو السطور القادمه بتمعن ..


ماهو الكهف: هو الغار و ملجأ من اذى قوم..

الموازين اذا اختلت يحدث الفساد العظيم.. هي تعدل ذاك الخلل

السعادة الحقيقه موجودة فيها ..
تعلمنا عدم اليأس والقنوط ..
اعظم فتنة فتنة الدين..
تعلمنا وتزرع بنا التفاؤل..والصبر
تعلمنا ان لاتهزم القلوب اذا كانت مع الله عز وجل..
تعلمنا الثبات على المبادئ وعدم التهور..
تبين لنا اسباب النجاة من الفتن .. واهمها الدعاء
الرفق والتطلف هو حل للمشكلات الحياة ..
بالشكر تدوم النعم..
العلم يحتاج الى بذل وجهد..
التواضع وصحبة الاخيار عدة للحياة..
وجوب الضيافه ..
صلاح الاباء من صلاح الابناء..
كم في المحن من منح..
العلم يجب ان يؤدي الى الرشد..
لابد ان تهيئ الامه الى ميادين الجهاد ..
http://www.google.com/url?source=imglanding&ct=img&q=https://lh3.googleuser*******.com/-jHccrIhHsOU/TjLSelCOixI/AAAAAAAAAGU/yNZkyUOQEXE/%25D9%2586%25D8%25AD%25D9%2586%2B%25D9%2582%25D9%2 588%25D9%2585%2B%25D8%25A7%25D8%25B9%25D8%25B2%25D 9%2586%25D8%25A7%2B%25D8%25A7%25D9%2584%25D9%2584% 25D9%2587.jpg&sa=X&ei=DyClTrH_Lo6K4gSss5XhBA&ved=0CAwQ8wc&usg=AFQjCNE5P-a5lPIDvOb01MMYlAU3t5kKsw

http://elmaghribya.com/ilham/hamsa/fwasel1/11tunisiacafe.gif (http://www.elmaghribya.com/vb/t72.html)

كل هذا واكثر موجوده في تلك السورة

التي والله حينما بحرت في معاني اياتها

وجدت نفسي في بحر لا ساحل له..

انها سورة الكهف,,

قال النبي صلى الله عليه وسلم

: «من قرأ سورة الكهف في يوم الجمعة أضاء له من النور ما بينه وبين الجمعتين

في ظل هذه الفتن التي نعيشها، الفتن ظلمات، وسورة الكهف تنير لك الطريق إلى الجمعة الأخرى، الذي يمشي في الظلمة ومعه نور، يسلم من أثر الظلمة، والذي ليس معه نور، قد يقع في حفرة أو يصيبه من الهوام والدواب ما الله به عليم، إذاً نحن بحاجة إلى قراءة هذه السورة في كل جمعة، حتى ننجو من هذه الفتن، حتى نخرج من هذا البلاء.

أسأل الله أن ينور قلوبنا وقلوبكم وأن ينفعنا بهذه السورة العظيمة


طلب من فضلكم :

خصص لنفسك ايها القارئ كل يوم ايه من سورة الكهف

لتقرأ تفسيرها وستجد مبتغاك في تغير حياتك..


الاعتزال المعنوي الذي قصدته : هو ان نقيم في نفوسنا كهف اعتزال معنوي

عن كل مكان فيه من المعاصي عن كل شيئ يبعدنا عن رب العزه.

بيتك اذا رأيت به من المعاصي غيره فأن لم تسطتع اهجره وارحل الى ذاك الكهف

نفسك أن وجدتها تريد كل شيئ تريد اهجرها وارحل الى ذاك الكهف

الكلام يطول .. وبقدر استطاعتي اختصرت مأاريد

يارب ان اصبت فمنك وحدك

وان اخطأت فمني ومن الشيطان

جعلنا الله واياكم من الذين يستمعون القول فيتبعون احسنه


ذلكم إسلامنا .. نوريضيء دروبنا ، و تاجٌ هلى هامات رؤوسنا ..

تمسكوا به ، وعضوا عليه بالنواجذ ..

سيروا على هديهِ قولاً وعملاً ، لتفلحوا به دنيا و أخرى ..

وتنال الفوز كل الفوز .. طالما تمسكتم بهويتكم الإسلامية واعتزيتم بها !

فاللهم أعزّنا بالإسلام ، وأعزّ الإسلام بنا

بعض الكلمات مقتبسه

من شيخنا ناصر العمر جزاه الله خير الجزاء وبارك به
لولا الله ثم هو لمى كتبت هذه السطور

..http://www.google.com/url?source=imglanding&ct=img&q=http://www13.0zz0.com/2010/10/10/21/452246199.jpg&sa=X&ei=NyClTpTJHo-L4gTejtXhBA&ved=0CAsQ8wc&usg=AFQjCNEwKYsDbO-fgP-CdfhPSAwKz4niKw ..

++++ فلاش رائع جدااا [[[غربآآء]]]

الاستماع من هنـــآآ http://hispanicmuslims.com/everwonder.swf

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-08, 13:55
السلام عليكم
مرحبا بعودتك اختي معا الى الله الثقل راجع الى كثرة الصور فهي تثقل الصفحات والمتفح فير فوكس احسن متصفح مع آخر اصداراته ستكون النتيجة مذهلة و ايضا خففي من ثقل الكمبيوتر بشكل عام و لا تفتحي اكثر من 3 او 4 صفحات في نفس المتصفح حتى لا يثقل ...
ارجو ان تعود الامور الى مسارها الصحيح معكي فقد افتقدناكي حقا...
اختي عطر لماذا مزاجكي معكر هل اغضبكي احد حتي لا تريدين الكتابة لابأس عليكي ان شاء الله ...
اخي محمد و الاخ ساجد شكرا لكما على الدرر التي تنثرانها في دارنا والله استفدنا منها كثيرا
اما الاخ مجيد فالدار داركم عنوان الموضوع يتحدث عن نفسه نحن هنا نمثل عائلة واحدة نتناقش الافكار نعرض الفوائد ...
نحكي ما يدور في رؤسنا و جد من يساعدنا ...
فأهلا بك ضيفا عزيزا و صاحب الدار قبل اهلها لنفد ونستفد معا دون الخروج عن قوانين المنتدى عامة والدار خاصة ارجو انك قد فهمت الموضوع...

سآجدْ للهْ
2012-02-08, 14:06
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||
وعليكم السلام

مرحبا اخت بيرلا تفضلي الدار دارك


|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-08, 14:47
معلومات غريبة
إذا مات الفيل وهو واقف فانه يظل واقفاً لبضع ساعات قبل أن يسقط أرضا.

ذكر الثعلب لا يقترن سوى بأنثى واحدة فقط طوال حياته ، وإذا ماتت تلك الأنثى فان الذكر يظل عزباً طوال حياته، أما إذا مات الذكر فإن الأنثى لا تتورع عن الارتباط بذكر جديد.

وضعية عيني الحمار في رأسه تسمح له برؤية حوافره الأربعة بشكل دائم في آن واحد.

زئير الأسد يمكن سماعه من على مسافة 8 كيلومترات

النعامة تعيش حتى 75 عاما وتظل قادرة على التكاثر حتى سن الخمسين

يستطيع رأس الثعبان أن يلدغ حتى بعد مرور نصف ساعة على بتره.

يتعين على معدة الإنسان أن تفرز بطانة مخاطية جديدة كل أسبوعين وإلا فإنها ستهضم نفسها.

هناك نوع من النمل يشتهر باسم «النمل السفاح» وذلك لأنه يشن غارات على مستعمرات النمل المجاورة له حيث يقتل ملكاتها وينهب محتوياتها ثم يقتاد عددا من ذلك النمل ويجبره على العمل كعبيد لديه!

النعامة لا تدفن رأسها في الرمال هرباً من الخطر بل بحثاً عن الماء.

لاحظ العلماء أن النمل «يتثاءب» كالبشر عندما يستيقظ من نومه في الصباح.

50 في المائة من الحرابي (جمع حرباء) الموجودة في العالم تتمركز في مدغشق

قبل بضع سنوات، ضربت صاعقة رعدية ملعبا لكرة القدم في جمهورية الكنغو الديمقراطية خلال إحدى المباريات ،الغريب أن تلك الصاعقة قتلت جميع لاعبي احد الفريقين في حين لم يصب أي لاعب من لاعبي الفريق المنافس بسوء.

أي قطعة ورق مربعة الشكل لا يمكن أن تطوى على نفسها أكثر من 8 مرات ، مهما كانت مساحتها كبيرة.

حجم الشمس يوازي 330330 مرة مقارنة بحجم الأرض.

عندما يولد الإنسان يكون في جسمه 300 عظمة ، إلا أن ذلك العدد يتراجع إلى 206 فقط عند الوصول إلى سن البلوغ

العضوان الوحيدان في جسم الإنسان اللذان لا يتوقفان عن النمو طوال الحياة هما الأنف والأذنان.

تحتوى معدة الإنسان على نحو 35 مليون غدة هضمية.

أقوى عضلة في جسم الإنسان,,, هي اللسان.

حجم قلب الحوت الأزرق البالغ يساوي حجم سيارة ، أما لسانه فيبلغ طوله نحو 5 أمتار.

من الناحية العلمية يعد الموز من الأعشاب بينما تعد الطماطم فاكهة.

تحتوي شبكية العين على نحو 135 مليون خلية حسية مسئولة عن التقاط الصور وتمييز الألوان.

عدد الأميين على مستوى العالم يبلغ نحو ملياري شخص.

مملكة «لوسوتو» الأفريقية محاطة من جميع جوانبها بجمهورية جنوب أفريقيا.

عدد السياح الذين يزورون فرنسا سنوياً يزيد على عدد سكانها الذي يبلغ نحو 60 مليون نسمة.

يوجد أكثر من 50 ألف نهر في الصين.

الفلفل الحار يحتوي على أعلى نسبة ممكنة من فيتامين «سي» مقارنة بجميع الخضراوات والفواكه الأخرى.

إجمالي ثروات أغنى 3 أشخاص في العالم يزيد بكثير على إجمالي الدخل السنوي الذي يحصل عليه 600 مليون شخص من سكان الدول الأكثر فقرا في العالم.

كشفت بحوث مخبريه عن أن دخان السجائر يحتوي على أكثر من 200 مادة كيماوية سامة من بينها 43 مادة على الأقل تسبب السرطان.

في مصر الفرعونية كان الأسبوع يتألف من 10 أيام. في مصر الفرعونية، كانت جثث نساء النبلاء تترك لبضعة أيام قبل أن تبدأ إجراءات تحنيطها، وكان الهدف من وراء ذلك هو السماح للجثة كي تفقدرونقها ونضارتها حتى لا تبدو مثيرة في نظر المحنطين .

السرعة القصوى للعيار الناري تبلغ حوالي 1065 متراً في الثانية أي ما يوازي 3 أضعاف سرعة الصوت تقريباً.

سآجدْ للهْ
2012-02-08, 14:54
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

شكت المحبرة الريشة , إنكِ تستنزفي كل ما أحمل من حبر

لتسطريه على بضع صفحات , ومتى ما انتهيتي من مهمتك

وانتهى حبري ألقيتي بي في سلة المهملات

أيا محبرتي لستِ محقة فيما تقولين ..!!

أنا كأنتِ , أنا رهينة حاملي ... ونهايتي كنهايتك

غير أنّا نرمى في المهملات ويبقى أثرنا على تلك الصفحات

إن كان هذا هو ما يغضبك يامحبرتي ..!!

أما ما يغضبني ويزعجني , وتدمع له عيني أشد أسى وألما ..!!

أكل هذا يا ريشتي يبدوا في الأمر سر خطير لا أعلمه .. ؟؟

هو خطير ... خطيرٌ جداً ... ولكن ليس سراً ... فالكل يعلمه ...

ولكن يتجاهله ويتغافل عنه ..!!

حيرتني في أمركِ ياريشتي .... ما الخطب ..؟؟

لو كان حاملي يسمع صوتي ... لسمع صرخاتي وآهاتي

ولرأى دمعاتي وعبراتي ... ليس كل حاملي لا والله

فهناك من يحملني وأتمنى أن يكمل المسير في حملي ...

وأن أبقى بين أحضان أنامله ...!!

لم أعد أفهم ما تقولين ياريشتي ... وأظنكِ تعيشين لحظة

حلم أو خيال ... وتُتمتمي وتتغني بذلك ..!!

لالا ليس ضرباً من الخيال , وسأُفسر لكِ ذلك ..!!

من يرسم البسمة على شفتاي ... والسعادة على محياي

يكتب ... صفحة وصفحات ... ورقة وورقات

لا أكلّ ولا أمل ولا ينتابني يأس ولاملل بل أتمنى ألا يتوقف ذلك المعين الصافي

... فذلك .... من يكتب دعوة لله ...

يكتب ... نصيحة وفائدة ... عظة وعبرة ... حكاية وقصة ... شعراً ونثرا

وكل ذلك ما كان لله ... فهو لايمل ... ولن يمل ..!!

أما لأخر ... لو استطعت لحطمت قيد أنامله ... ولكسرت أصابعه

لأخرج من بينها قبل أن يكتب حرفاً واحد ..!!

لم يترك باباً لشرِ إلاّ فتحه ... ولا ألفاظ نابية إلاّ خطها

بالنكت الهزلية تارة ... وبالسخرية تارة ... وبالإستهزاء تارة أخرى ..

... حتى علماء الأمة لم يسلموا من شر حرفه ...

وي كأنه لا يعلم أنه يكتب ... وهناك ملك يكتب ماله وما عليه ..!!

محبرتي ... ألا توافقيني الرأي ..!! ألستُ محقة في الصراخ والبكاء عليهم .

أيا ريشتي أنتِ محقة ... ظالمين لأنفسهم أؤلائك يظنون أنهم ليسوا محاسبين

على ما تخطه أقلامهم ... وما تكتب أناملهم ..!!

... نعم والله إنهم ظالمي أنفسهم ...

... ريشتي ... ريشتي ...

مالخبر يامحبرتي ...!!!

أكتبتي نقاشنا ياريشتي ..؟؟

نعم ... نعم ... فمثل ذلك النقاش لا أمله ولاتمل منه الكتابة ..!!

ولننتهي أنا وأنتِ ياريشتي ... لعل حاملنا يعلم لما انتهينا ...!!

ولآن يا قارئ ما كتبنا أي الفريقين أنت ؟؟!!

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

سآجدْ للهْ
2012-02-08, 15:56
|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

انا في مشكلـــــة :o:o:o:o:o:o:o:o

|||ردد معي|||~~~|||~~~|||الله|||~~~|||أكبر|||
|||~~~|||~~~|||~~~اللهم ارزقنا الجــــــــــــــنه امين
|||ردد معي|||سبحان|||~~~|||الله|||~~~|||وبحمده|||

آلاء الرحـــــــمن
2012-02-08, 16:21
خيرا اخي ماهي مشكلتك ؟ عسى ان لا تكون مشكلة كبيرة

عطر الملكة
2012-02-08, 16:57
السلام عليكم

اختي عطر لماذا مزاجكي معكر هل اغضبكي احد حتي لا تريدين الكتابة لابأس عليكي ان شاء الله ...

اشكر اهتمامك غاليتي
و لا داعي للقلق فقد تعلمت درس جيد من هذ المنتدى لا احد يستحق ان اعطيه حيز من اهتمامي او تفكيري
كل واحد حر في طريقة تفكيره و لست مضطرة لفعل امور ضد قناعتي
انا مثلما انا بكل سلبياتي و ايجابياتي

آلاء الرحـــــــمن
2012-02-08, 17:09
اشكر اهتمامك غاليتي
و لا داعي للقلق فقد تعلمت درس جيد من هذ المنتدى لا احد يستحق ان اعطيه حيز من اهتمامي او تفكيري
كل واحد حر في طريقة تفكيره و لست مضطرة لفعل امور ضد قناعتي
انا مثلما انا بكل سلبياتي و ايجابياتي

مرحبا بك عزيزتي
حرية التفكير حق وحرية ابداء الراي المخالف ايضا حق ...
النقاش يكون ايجابي او سلبي بحسب من تناقشين فالمتعصب لرأيه وإن بدى له خطئه لا يستحق النقاش وبذل مجهود معه
اما الانسان المتفهم المتحاور الجيد الذي حينما يظهر له خطأه يعتذر ويصحح مفاهميه المغلوطة فهذا مناقشته مكسب و فائدة وزيادة خبرة ...
فلا تيأسي عزيزتي وأعلمي ان من خالفكي في الرأي ليس بالضرورة انه يكرهك وان من وافقك في الرأي ليس بالضرورة ايضا انه يحبك...
المهم ان لا تبخلينا بمشاركتك العطرة التي تزيد الموضوع رونقا آخر و لا تيأسي ولا يحبط من عزيمتك من خالفكي ....

محمد جديدي التبسي
2012-02-08, 19:31
أنواع القلوب في القرآن

ذكر الله سبحانه و تعالى في القرآن الكريم أنواعاً كثيرة من القلوب منها

القلب السليم
وهو مخلص لله وخالٍ من من الكفر والنفاق والرذيلة
{ إِلَّا مَنْ أَتَى اللَّهَ بِقَلْبٍ سَلِيمٍ }

القلب المنيب
وهو دائم الرجوع والتوبة إلى الله مقبل على طاعته
{ مَنْ خَشِيَ الرَّحْمَن بِالْغَيْبِ وَجَاء بِقَلْبٍ مُّنِيبٍ }

القلب المخبت
الخاضع المطمئن الساكن
َ{ فتُخْبِتَ لَهُ قُلُوبُهُمْ }

القلب الوجل :
وهو الذي يخاف الله عز وجل ألا يقبل منه العمل ، وألا ينجى من عذاب ربه
{ وَالَّذِينَ يُؤْتُونَ مَا آتَوا وَّقُلُوبُهُمْ وَجِلَةٌ أَنَّهُمْ إِلَى رَبِّهِمْ رَاجِعُونَ }

القلب التقي
وهو الذي يعظّم شعائر الله
{ ذَلِكَ وَمَن يُعَظِّمْ شَعَائِرَ اللَّهِ فَإِنَّهَا مِن تَقْوَى الْقُلُوبِ }

القلب المهدي
الراضي بقضاء الله والتسليم بأمره
{ وَمَن يُؤْمِن بِاللَّهِ يَهْدِ قَلْبَهُ }

القلب المطمئن
يسكن بتوحيد الله وذكره
َ{ وتَطْمَئِنُّ قُلُوبُهُم بِذِكْرِ اللّه }

القلب الحي
قَلْب يَعْقِل مَا قَدْ سَمِعَ مِنْ الْأَحَادِيث الَّتِي ضَرَبَ اللَّه بِهَا مَنْ عَصَاهُ مِنْ الْأُمَم
{ إِنَّ فِي ذَلِكَ لَذِكْرَى لِمَن كَانَ لَهُ قَلْبٌ }

القلب المريض
وهو الذي أصابه مرض مثل الشك أو النفاق وفيه فجور ومرض في الشهوة الحرام
{ فَيَطْمَعَ الَّذِي فِي قَلْبِهِ مَرَضٌ }

القلب الأعمى
وهو الذي لا يبصر ولايدرك الحق والإعتبار
{ وَلَكِن تَعْمَى الْقُلُوبُ الَّتِي فِي الصُّدُورِ }

القلب اللاهي
غافل عن القرآن الكريم, مشغول بأباطيل الدنيا وشهواتها, لا يعقل ما فيه
{ لاهِيَةً قُلُوبُهُمْ }

القلب الآثم
وهو الذي يكتم شهادة الحق
{ وَلاَ تَكْتُمُواْ الشَّهَادَةَ وَمَن يَكْتُمْهَا فَإِنَّهُ آثِمٌ قَلْبُهُ }

القلب المتكبر
مستكبر عن توحيد الله وطاعته, جبار بكثرة ظلمه وعدوانه
َ { قلْبِ مُتَكَبِّرٍ جَبَّارٍ }

القلب الغليظ
وهو الذي نُزعت منه الرأفة والرحمة
{ وَلَوْ كُنتَ فَظّاً غَلِيظَ الْقَلْبِ لاَنفَضُّواْ مِنْ حَوْلِكَ }

القلب المختوم :
فلم يسمع الهدى ولم يعقله .
{ وَخَتَمَ عَلَى سَمْعِهِ وَقَلْبِهِ }

القلب القاسي :
لا يلين للإيمان, ولا يؤثِّرُ فيه زجر وأعرض عن ذكر الله
{ وَجَعَلْنَا قُلُوبَهُمْ قَاسِيَةً }

القلب الغافل:
غافلا عن ذكرنا، وآثَرَ هواه على طاعة مولاه
{ وَلَا تُطِعْ مَنْ أَغْفَلْنَا قَلْبَهُ عَن ذِكْرِنَا }

الَقلب الأغلف
قلب مغطى, لا يَنْفُذ إليها قول الرسول صل الله عليه وسلم
{ وَقَالُواْ قُلُوبُنَا غُلْفٌ }

القلب الزائغ
مائل عن الحق
َ{ فأَمَّا الَّذِينَ في قُلُوبِهِمْ زَيْغٌ }

القلب المريب
شاكٍ متحير
{ وَارْتَابَتْ قُلُوبُهُمْ }

اللهم ثبت قلوبنا على دينك يارب العالمين
اللهم اجعل قلوبنا من القلوب السليمة المنيبة يا ارحم الراحمين

هيا الجزائر
2012-02-08, 20:18
مساء النور والانوار
عساكم بخير ان شاء الله
الــلــهــم أذق قــلــوب أحــبـّـتــي بــرد عــفــوك وحــلاوة حــبـّـك .. وافــتــح مــســامــع قــلــوبــهــم لــذكــرك و خــشــيــتــك .. و اغــفــر لــهــم بــكــرمــك .. و أدخــلــهــم جــنـّـتــك بــرحــمــتــك

http://profile.ak.fbcdn.net/hprofile-ak-snc4/161484_100003376710196_525991093_n.jpg (http://www.********.com/media/set/?set=a.100172760105281.84.100003376710196&type=1)

2012-02-08, 21:08
وصف الجنة


لبنة من فضة ولبنة من ذهب وبلاطها المسك وحصاؤها اللؤلؤ والياقوت وتربتها الزعفران ومن صلى في اليوم اثنتي عشرة ركعة بنى له بيت في الجنة.


فيها ثمانية أبواب وفيها باب اسمه الريان لا يدخله إلا الصائمون وعرض الباب مسيرة الراكب السريع ثلاث أيام ويأتي عليه يوم يزدحم الناس فيه.


فيها مائة درجة ما بين كل درجتين كما بين السماء والأرض والفردوس أعلاها، ومنها تفجر أنهار الجنة ومن فوقها عرش الرحمن.


فيها نهر من عسل مصفى، ونهر من لبن، ونهر من خمر لذة للشاربين، ونهر من ماء، وفيها نهر الكوثر للنبي محمد عليه السلام أشد بياضاً من اللبن وأحلى من العسل فيه طير أعناقها كأعناق الجزر ـ أي الجمال ـ. أشجارها

إن فيها شجرة يسير الراكب في ظلها مائة عام لا يقطعها وإن أشجارها دائمة العطاء قريبة دانية مذللة.


فيها خيمة مجوفة من اللؤلؤ عرضها ستون ميلاً في كل زاوية فيها أهل يطوف عليهم المؤمن.

أهل الجنة

أهل الجنة جرد مرد مكحلين لا يفنى شبابهم ولا تبلى ثيابهم وأول زمرة يدخلون على صورة القمر ليلة البدر لا يبولون ولا يتغوطون ولا يمتخطون ولا يتفلون أمشاطهم الذهب ورشحهم المسك ومباخرهم من البخور.

نساء أهل الجنة

لو أن امرأة من نساء الجنة اطلعت إلى الأرض لأضاءت ما بينهما ولملأت ما بينهما ريحاً ويرى مخ سوقهما من وراء اللحم من الحسن ولنصيفها على رأسها خير من الدنيا وما فيها.

أول من يدخل الجنة

نبينا محمد صلى الله عليه وسلم وأبو بكر الصديق، وأول ثلاثة يدخلون: الشهيد، وعفيف متعفف، وعبد أحسن عبادة الله ونصح مواليه.

نعيم آخر أهل الجنة

يقال له تمنى فعندما يتمنى يقال له لك الذي تمنيت وعشرة أضعاف الدنيا.

سادة أهل الجنة

سيدا الكهول أبو بكر وعمر، وسيدا الشباب الحسن والحسين، وسيدات نساء أهل الجنة خديجة بنت خويلد، وفاطمة بنت محمد، ومريم ابنة عمران، وآسية بنت مزاحم امرأة فرعون.

خدم أهل الجنة

ولدان مخلدون لا تزيد أعمارهم عن تلك السن إذا رأيتهم كأنهم لؤلؤ منثور ينتشرون في قضاء حوائج السادة.

النظر إلى وجه الله تعالى

من أعظم النعيم لأهل الجنة رؤية الرب عز وجل

{وجوه يومئذ ناضرة، إلى ربها ناظرة} (سورة القيامة/22،23)

وصف النـار والعياذ بالله

منها يدخل الكافرون النار وأما المؤمنون وفيهم المنافقون فيتوجهون إلى الصراط


لها سبعة أبواب وإن نارنا في الدنيا جزء من سبعين جزءا من حر جهنم.

صفات أهل النار

ما بين منكبي الكافر مسيرة ثلاثة أيام للراكب السريع، وضرسه مثل جبل أحد، وغلظ جلده مسيرة ثلاث.

شرابهم وطعامهم

الماء الحار شرابهم، يصب على رؤوسهم فينفذ حتى يخلص إلى جوفه ويمرق من قدميه ثم يعاد كما كان، ولو أن قطرة من الزقوم قطرات في دار الدنيا لأفسدت على أهل الأرض معايشهم، وطعامهم الغسلين، وهو ما سال من جلود أهل النار من القيح والصديد وهو ما يسيل من لحم الكافر.

أهون المعذبين

أهون أهل النار عذاباً من توضع في أخمص قدميه جمرتان يغلي منهما دماغه.


لو أن حجراً ألقى في جهنم يهوى بها سبعين سنة لا يصل إلى قعرها.

وقود النار الناس وهم الكفرة والمشركين والحجارة هم وقود النار وقال ابن مسعود هي حجارة من كبريت. شدة حرها فهواؤها السموم وهو الريح الحارة، وظلها اليحموم وهو قطع الدخان، وماؤها الحميم، وأنها تأكل كل شيء لا تبقى ولا تذر، تحرق الجلود وتصل إلى العظام وتطلع على الأفئدة.


إذا رأوها من بعيد يسمعون لها تغيظاً وزفيراً وتنادي ثلاثة أصناف: الجبار العنيد، وكل من دعا مع الله إلهاً آخر، والمصورين.

كثرة أهلها

من يدخل النار أكثر ممن يدخل الجنة {وما أكثر الناس ولو حرصت بمؤمنين} (سورة يوسف/103)


تفصل لهم ملابس من النار.

أنواع العذاب

إنضاج الجلود، والصهر وهو صب الحميم على رؤوسهم، واللفح فيكبون على وجوههم،

والسحب سحب الكفار على وجوههم وتسويد الوجوه، وإحاطة النار بهم، واطلاعهم على

الأفئدة، واندلاق الأمعاء فيها، ويقيدون بالسلاسل والأغلال والمطارق وقرن معبوداتهم وشياطينهم معهم.

اللَّهُمَّ ارزقنا الخُلْدَ في جنانِك، وأحِلَّ علينا فيها رضوانَك، وارزقْنا لَذَّة النظرِ إلى وجهك والشوقَ إلى لقائك من غيرِ ضرَّاءَ مُضِرَّة ولا فتنةٍ مُضلةٍ.

اللَّهُمَّ صلِّ وسلَّم وبارِكْ على عبدِك ونبيِّك محمدٍ وعلى آلِهِ وأصحابِه أجمعين.

آلاء الرحـــــــمن
2012-02-08, 22:22
يبدو انه لا احد في الدار اين انتم اخواني
يعني ذهبت الاخت معا الى الله معذورة ذهبتم معها
والله القعدة لا تحلو بدونها و لكن لازم نتهلاو في دارها و دارنا في غيابها آملين ان لا تطيل الغياب

آلاء الرحـــــــمن
2012-02-08, 22:31
اخبري من وراءك من النساء
وفدت اسماء بنت يزيد على النبي صلى الله عليه وسلم فقالت : بأبي انت وأمي يارسول الله إنه ليس في شرق البلاد وغربها امرأة الا وهي مثل رأيي إن الله تعالى بعثك الى الرجال والنساء فأمنا بك وبإلهك الذي بعثك وإنا معشر النساء محصورات مقصورات قوامات بيوتكم وحاملات اولادكم وحافظات اموالكم , وخوالفكم في سفركم , وممرضاتكم في الحضر .
وإنكم معشر الرجال فضلتم علينا بالجمع والجماعات , وعيادة المرضى , وشهود الجنائز , والحج والعمرة , وأفضل من ذلك كله الجهاد في سبيل الله , وإنكم إذا خرجتم حجاجا ومجاهدين , وتجارا ومسافرين حفظنا لكم أموالكم وربينا لكم اولادكم ثم غزلنا لكم الاثواب وجمعنا لكم الطعام .
أفشارككم في الاجر يارسول الله ؟؟
فأقبل النبي صلى الله عليه وسلم على اصحابه وقال لهم :
((هل سمعتم مقالة امرأة قط احسن من مقالتها في حسن مساءلتها عن امر دينها ؟ ))
ثم اقبل عليها فقال :
((ارجعي أيتها المرأة فاخبري من وراءك من النساء ان حسن تبعل إحداكن لزوجها واجتنابها سخطه , واتباعها مرضاته يعدل ذلك كله. ))
فولت المرأة تكبر وتهلل استبشارا
فلتنظر النساء اي فضل فضلهن به الاسلام

آلاء الرحـــــــمن
2012-02-08, 22:46
ضرر النفخ في الطعام


هذه صورة مجهرية لنوع من أنواع البكتريا اسمها Helicobacter pylori والتي تعيش في الفم وفي خروجها من الفم إلى الطعام يمكن أن تسبب عدة أمراض منها القرحة المعدية .
النفخ في الطعام والشراب أو إخراج النفس فيه عادة يومية يفعلها الإنسان دائما عندما يأكل أو يشرب شيئاً ساخناً بغرض تبريده، ولكنها
للأسف عادة خاطئة جدا وقد تؤدي للإصابة بداء السكري أو إلتهاب الأغشية المبطنة للمعدة القرحة Ulcer) ).
عن ابن عباس رضي الله عنه أنه صلى الله عليه وسلم نهى عن النفخ في الطعام والشراب.صحيح الجامع للسيوطي تخريج الألباني حديث صحيح.
وقال صلى الله عليه وسلم (إذا شرب أحدكم فلا يتنفس في الإناء ) رواه البخاري(149).
سواء انفرد بالشرب من هذا الإناء، أو شاركه فيه غيره، وهذا من مكارم الأخلاق التي علمها النبي صلى الله عليه وسلم لأمته.
وقال العلامة المناوي رحمه الله في ‘فيض القدير ‘(6/346): ’والنفخ في الطعام الحار يدل على العجلة الدالة على الشَّرَه وعدم الصبر وقلة المروءة’ انتهى .
وهذا النهي عن الأمرين للكراهة، فمن فعلهما أو أحدهما لا يأثم إلا أنه قد فاته أجر امتثال هذه التوجيهات النبوية.
من الجانب العلمي..
ففي الإنسان تعيش بكتيريا يكون عددها أكثر من عدد خلاياه ولكنها بفضل الله ورحمته نافعة للجسم وغير ضاره بحيث أنها تقوم بعمليات
تنشيط التفاعلات الحيوية وأيضا التفاعلات اللازمة للهضم.
وتوجد بعض من هذه البكتيريا بالملايين في الفم، ونوع من هذه البكتيريا يسمى Helicobacter pylori كما هو
موضح في الصورة التالية:

شكل البكتيريا ومكان تواجدها بالمعدة

تقوم تلك البكتيريا عندما تخرج من الفم بواسطة النفخ بالتحوصل على الطعام الساخن حيث أن البكتيريا كائنات حساسة للحرارة ثم يتناول الإنسان
ذلك الطعام حيث تتواجد البكتيريا فيه بشكل كبير جدا وتكون في أتم الاستعداد للدخول إلى داخل الجسم، تخيل كم مرة يقوم الإنسان بالنفخ في ذلك الطعام وكم هي كمية البكتيريا المتواجدة فيه! ثم يقوم الإنسان بتناول ذلك الطعام مع تلك البكتيريا المتحوصلة.
تبدأ الرحلة من الفم ومن ثم المرئ إلى أن تصل إلى المعدة فتقوم تلك البكتيريا بالتنشيط و إفراز انزيم اليوريا Urease enzyme الذي يسبب التهاب الأغشية المبطنة للمعدة مسببا بذلك خرقا في الجدار حيث تبدأ المعدة بهضم نفسها وحدوث تآكل بجدار المعدة مما يؤدي إلى هضم المعدة لنفسها.


آلية عمل البكتيريا وحدوث القرحة داخل المعدة أيضا تسبب تلك البكتيريا ضعفا في إفراز الأنسولين بالبنكرياس مما يؤدي إلى ارتفاع نسبة السكر بالدم وحدوث مرض السكري.
الوقاية من ذلك كله تتمثل في الحفاظ على نظافة الفم واستعمال السواك أو الفرشاة والمعجون أو حتى المضمضة كما يحدث عند الوضوء.
هذا والله تعالى أعلى وأعلم وعافانا الله وإياكم .

عطر الملكة
2012-02-08, 22:49
أسوأ الأزمنة!
زمن تختلط فيه اقدار الناس ... يصبح الصغير كبيراً
ويصبح الكبير صغيراً ويغدو فيه الجاهل عالماً .. ويصبح العالم
جاهلاً .. ويموت فيه أصحاب المواهب ويقفز على قمته الجهلاء

×?°أسوأ الأوطان! ×?°

وطن يعطيه الإنسان عمراً ويبخل عليه بساعة صفاء


×?°أسوأ المشاعر! ×?°

أن يصبح مصيري في يد من لا يعرف قدري ... وأن أنام خائفاً
من ان أمسي ومنزعجاً من يومي ومتحسراً على ماهو اتي!!!


×?°أسوأ الشعــوب!×?°

شعوب تمسك بها النيران من كل جانب ولا تحاول حتى أن
تصرخ .. وتحيط بها النكبات من كل مكان ولا تحاول حتى أن
ترفض ... ويحكمها الشر وترضى .. ويسود فيها الصغار
وترضخ ... ويذبح فيها الشرفاء كل يوم .. وتضحك!!!


×?°أسوأ العقول! ×?°

عقل يرفض كل شئ أو يقبل كل شئ
يذكرني بمحطات القطارات ... باب للدخول .. وباب للخروج ... ولا يبقى فيها أحد!!


×?°أسوأ الذكريات! ×?°

إنسان أحببته ولا تتمنى أن تراه!!


×?°أسوأ صداقه ! ×?°

ان يكون قلبك ممتلئ بكل الشوق والحنين..وتلقى شعور معاكس وبرود قاتل
من الذين حفرت اسمائهم على لوح الصداقه الحقيقيه


×?°أسوأ المواقف !×?°

أن تكون محباَ غير محبوب


×?°أجمل الأزمنة! ×?°

زمان يعرف قدري .. ينصفني إذا أعطيت .. يعاقبني إذا
أخطأت .. لا مكان فيه لحاقد أو مزيف أو دجال


×?°أجمل الاوطان! ×?°

وطن يعطيني بقدر عطائي ولا يخذلني في حبي


×?°أجمل المشاعر! ×?°

لحظة أتمنى أن أعيشها ألف مرة ولا أشبع منها ابداً


×?°أجمل إبتسامه !×?°

ابتسامه ساحره تصل الى القلب
فتجعلك تنسى الألم وتبتسم..


×?°أفضل الشعوب! ×?°

شعوب تصنع العدل بالحكمة ... وتقوم الحكام بالعدل
وتطفئ النيران قبل أن تكبر ... وترفع كبارها
وتعلي شرفاؤها


×?°أفضل العقول!×?°

عقل لا يمل البحث عن الحقيقة


×?°أفضل القلوب! ×?°

قلب لا يغيب عنه الصدق


×?°أفضل صديق !×?°

صديق لا ينساك ... لأنه يحبك


×?°من اصعب الأشياء !×?°

ان يخونك لسانك في موقف انت في اشد الحاجه له
ما أصعب أن تبكي بلا .. " دموع"

وما أصعـــــب أن تذهب بلا .. " رجوع "

وما اصعب أن تشعر بالضيق وكأن المكان من حولك يضــــــيق

آلاء الرحـــــــمن
2012-02-08, 23:02
” كأنني أكلت ” هو أغرب اسم لمسجد في العالم

مسجد ” كأنني أكلت ”
هل سمع أحد بمثل هذا الاسم الغريب ؟
هو جامع صغير في منطقة ‘فاتح’ في اسطنبول واسم الجامع باللغة التركية هو ‘ صانكي يدم ‘ أي ” كأنني أكلت ” ووراء هذا الاسم الغريب قصــة … وفيها عبرة كبير ة .
في كتابه الشيق ‘ روائع من التاريخ العثماني ‘ كتب الأستاذ الفاضل ‘أورخان محمد علي’
قصة هذ ا الجامع .. فيقو ل أنه :
كان يعيش في منطقة ‘فاتح’ شخص ورع اسمه خير الدين أفندي، كان صاحبنا هذا عندما يمشي في السوق ، وتتوق نفسه لشراء فاكهة ، ‘أو لحم ، أو حلوى ، يقول في نفسه : ‘ صانكي يدم’ .. يعني كأنني أكلت ‘ أو ‘ افترض أنني أكلت ‘!! …. ثم يضع ثمن ذلك
الطعـام في صندوق له …… ومضت الأشهر والسنوات . .. وهو يكف نفسه عن لذائذ الأكل … ويكتفي بما يقيم أوده فقط ، وكانت النقود تزداد في صندوقه شيئا فشيئا ، حتى استطاع بهذا المبلغ القيام ببناء مسجد صغير في محلته ، ولما كان أهل المحلة يعرفون قصة هذا الشخص الورع الفقيــــر، وكيف استطاع أن يبني هذا المسجد , أطلقوا على الجامع اسم جامع : صانكي يدم
*كم من المال سنجمع للفقراء والمحتاجين
*وكم من المشاريع سنشيد في مجتمعنا وفي العالم
*وكم من فقير سنسد جوعه وحاجته
*وكم من القصور سنشيد في منازلنا في الجنة إن شاء الله
*وكم من الحرام والشبهات سنتجنب لو أننا اتبعنا منهج ذلك الفقير الورع
وقلنا كلما دعتنا أنفسنا لشهوة زائدة على حاجتنا ‘ كأنني أكلت ‘

عطر الملكة
2012-02-08, 23:08
” كأنني أكلت ” هو أغرب اسم لمسجد في العالم

مسجد ” كأنني أكلت ”
هل سمع أحد بمثل هذا الاسم الغريب ؟
هو جامع صغير في منطقة ‘فاتح’ في اسطنبول واسم الجامع باللغة التركية هو ‘ صانكي يدم ‘ أي ” كأنني أكلت ” ووراء هذا الاسم الغريب قصــة … وفيها عبرة كبير ة .
في كتابه الشيق ‘ روائع من التاريخ العثماني ‘ كتب الأستاذ الفاضل ‘أورخان محمد علي’
قصة هذ ا الجامع .. فيقو ل أنه :
كان يعيش في منطقة ‘فاتح’ شخص ورع اسمه خير الدين أفندي، كان صاحبنا هذا عندما يمشي في السوق ، وتتوق نفسه لشراء فاكهة ، ‘أو لحم ، أو حلوى ، يقول في نفسه : ‘ صانكي يدم’ .. يعني كأنني أكلت ‘ أو ‘ افترض أنني أكلت ‘!! …. ثم يضع ثمن ذلك
الطعـام في صندوق له …… ومضت الأشهر والسنوات . .. وهو يكف نفسه عن لذائذ الأكل … ويكتفي بما يقيم أوده فقط ، وكانت النقود تزداد في صندوقه شيئا فشيئا ، حتى استطاع بهذا المبلغ القيام ببناء مسجد صغير في محلته ، ولما كان أهل المحلة يعرفون قصة هذا الشخص الورع الفقيــــر، وكيف استطاع أن يبني هذا المسجد , أطلقوا على الجامع اسم جامع : صانكي يدم
*كم من المال سنجمع للفقراء والمحتاجين
*وكم من المشاريع سنشيد في مجتمعنا وفي العالم
*وكم من فقير سنسد جوعه وحاجته
*وكم من القصور سنشيد في منازلنا في الجنة إن شاء الله
*وكم من الحرام والشبهات سنتجنب لو أننا اتبعنا منهج ذلك الفقير الورع
وقلنا كلما دعتنا أنفسنا لشهوة زائدة على حاجتنا ‘ كأنني أكلت ‘

آه بيرلا القصة غريبة و جميلة في نفس الوقت شدت انتباهي لما فيها من عبرة
اضافة انها مرتبطة بمدينة احبها كثيرا و اتمنى ازورها اسطمبول
مشكورة غاليتي على الانتقاء الجيد

آلاء الرحـــــــمن
2012-02-08, 23:13
آه بيرلا القصة غريبة و جميلة في نفس الوقت شدت انتباهي لما فيها من عبرة
اضافة انها مرتبطة بمدينة احبها كثيرا و اتمنى ازورها اسطمبول
مشكورة غاليتي على الانتقاء الجيد

اهلا بك عزيزتي
انا ايضا معجبة جدا بمدينة اسطنبول وتركيا عموما ففيها مواقع واماكن تستحق الزيارة
هذا طبعا بعد زيارتنا للبقاع المقدسة عاجلا غير آجل ان شاء الله

عطر الملكة
2012-02-08, 23:21
اهلا بك عزيزتي
انا ايضا معجبة جدا بمدينة اسطنبول وتركيا عموما ففيها مواقع واماكن تستحق الزيارة
هذا طبعا بعد زيارتنا للبقاع المقدسة عاجلا غير آجل ان شاء الله

اكيد البقاع المقدسة هذا يعتبر امر مفروغ منه ربما هذا العام ساقوم بعمرة انا و والدتي
اما باقي المدن التي لا تفارق احلامي رغم انها في منها صعب التحقق نوعاما
في الدول العربية اتمنى زيارة مصر و بلاد الشام سوريا ولبنان و الاردن
و في تركيا و ايطاليا و اليونان
يلا تبقى احلام الحمد لله ان الاحلام مجانية
تصبحون على خير

2012-02-08, 23:21
صبااااااااااااااااااااااااح الخير

2012-02-08, 23:32
وقيل كاااااااااااامل رقدتووووووووووووووو

آلاء الرحـــــــمن
2012-02-08, 23:38
معلومات حول طبيعة الآثار المصرية العملاقة

حجم الحجر المستخدم في تشييد تلك المباني يصل في بعض الأحيان إلى عشرات الأمتار المكعبة !!

العدد التقريبي لحجارة الهرم الأكبر وحده هو 2.3 مليون صخرة !! ولضخامة العدد، لو تم استخدام صخور الهرم الأكبر وحده لبنت سور يحيط بالعالم بارتفاع 30 سنتيمتر، أو يحيط بكامل فرنسا بارتفاع 3 أمتار، أو بحدود مصر حاليا بارتفاع 1.5 متر

متوسط وزن الحجر بالهرم الأكبر هو 2.5 طن ( ألفين وخمسمائة كيلوجرام !! )

سقف الحجرة الرئيسية بالهرم الأكبر ( والتي يزعمونو أنها تخص خوفو ) يقدر وزنه ما بين 15 حتى 35 طن !!

أثقل حجر هو رأس أبو الهول المنحوت من صخرة واحدة ويقدر وزنه بألف طن ( مليون كيلوجرام ) !!!! وهو يحتاج لسبعة طائرات جامبو لتحريكه !!

المسافات بين موقع تقطيع الحجارة وأماكن التشييد تبدأ من 35 كيلومتر بالمعادي ووصلت في بعض الأحيان إلى 650 كيلومتر من أسوان !!

ارتفاع البناء وصل إلى 163 متر !!

2012-02-08, 23:47
عندما يقول لك أحد أبشرك ....... :
بــبشرى سوف تفرح !
فكيف اذا .......
كان القائل هو الله سبحانه
"وبشر الصابرين" .......
فماذا تتوقع أعد لهم..؟
بشرنا الله واياكم بما يسر قلوبنا ويجبر خواطرنا اللهم امين .......

{ هُدُووء قَاتِلْ ~ }
2012-02-09, 09:24
وَعليكٌم السَلامُ ورحَمةُ الله وبركَاتُه
صَباحُكم مِسكْ ، كيفَ أنتُم ؟

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-09, 11:45
ـأَسْعَدَ {الله} أَوْقَآتكُمْ بِكٌلٍّ خَيْرٍ يَآ أَهْلَ الدّآرْ


يحكى أنه حدثت مجاعة ...

فطلب الوالي من أهل القرية طلبًا غريبًا في محاولة منه لمواجهة

خطر القحط والجوع

وأخبرهم بأنه سيضع قِدرًا كبيرًا في وسط القرية

وأن على كل رجل وامرأة أن يضع في القِدر كوبًا من اللبن
بشرط أن يضع كل واحد الكوب لوحده من غير أن يشاهده أحد.

هرع الناس لتلبية طلب الوالي..
كل منهم تخفى بالليل وسكب ما في الكوب الذي يخصه.

وفي الصباح ,, فتح الوالي القدر .... وماذا شاهد؟

شاهد القدر و قد امتلأ بالماء!!!

أين اللبن؟!

ولماذا وضع كل واحد من الرعية الماء بدلاً من اللبن؟

كل واحد من الرعية.. قال في نفسه:

" إن وضعي لكوب واحد من الماء لن يؤثر على
كمية اللبن الكبيرة التي سيضعها أهل القرية ".

وكل منهم اعتمد على غيره ...
وكل منهم فكر بالطريقة نفسها التي فكر بها أخوه, و ظن أنه
هو الوحيد الذي سكب ماءً بدلاً من اللبن,

والنتيجة التي حدثت..
أن الجوع عم هذه القرية ومات الكثيرون منهم ولم يجدوا
مايعينهم وقت الأزمات ..

هل تصدق أنك تملأ الأكواب بالماء
في أشد الأوقات التي نحتاج منك أن تملأها باللبن؟

لا تتقن عملك بحجة أنه لن يظهر وسط الأعمال الكثيرة
التي سيقوم بها غيرك من الناس
فأنت تملا الأكواب بالماء...

لا تخلص نيتك في عمل تعمله ظناً منك أن كل الآخرين قد أخلصوا نيتهم
وان ذلك لن يؤثر
فأنت تملا الأكواب بالماء...

تحرم فقراءالمسلمين من مالك ظناً منك أن غيرك سيتكفل بهم.
فأنت تملا الأكواب بالماء...

تتقاعس عن الدعاء للمسلمين بالنصرة والرحمة و المغفرة
فأنت تملا الأكواب بالماء...

تترك ذكر الله و الاستغفار و قيام الليل.
فأنت تملا الأكواب بالماء...


تضيع وقتك ولا تستفيد منه بالدراسة والتعلم
والدعوة إلى الله تعالى.
فأنت تملا الأكواب بالماء.

سفيان القاسمي
2012-02-09, 12:02
” كأنني أكلت ” هو أغرب اسم لمسجد في العالم

مسجد” كأنني أكلت ”

هل سمع أحد بمثل هذا الاسم الغريب ؟
هو جامع صغير في منطقة ‘فاتح’ في اسطنبول واسم الجامع باللغة التركية هو ‘ صانكي يدم ‘ أي ” كأنني أكلت ” ووراء هذا الاسم الغريب قصــة … وفيها عبرة كبير ة .
في كتابه الشيق ‘ روائع من التاريخ العثماني ‘ كتب الأستاذ الفاضل ‘أورخان محمد علي’

قصة هذ ا الجامع .. فيقو ل أنه :

كان يعيش في منطقة ‘فاتح’ شخص ورع اسمه خير الدين أفندي، كان صاحبنا هذا عندما يمشي في السوق ، وتتوق نفسه لشراء فاكهة ، ‘أو لحم ، أو حلوى ، يقول في نفسه : ‘ صانكي يدم’ .. يعني كأنني أكلت ‘ أو ‘ افترض أنني أكلت ‘!! …. ثم يضع ثمن ذلك
الطعـام في صندوق له …… ومضت الأشهر والسنوات . .. وهو يكف نفسه عن لذائذ الأكل … ويكتفي بما يقيم أوده فقط ، وكانت النقود تزداد في صندوقه شيئا فشيئا ، حتى استطاع بهذا المبلغ القيام ببناء مسجد صغير في محلته ، ولما كان أهل المحلة يعرفون قصة هذا الشخص الورع الفقيــــر، وكيف استطاع أن يبني هذا المسجد , أطلقوا على الجامع اسم جامع : صانكي يدم

*كم من المال سنجمع للفقراء والمحتاجين

*وكم من المشاريع سنشيد في مجتمعنا وفي العالم
*وكم من فقير سنسد جوعه وحاجته
*وكم من القصور سنشيد في منازلنا في الجنة إن شاء الله
*وكم من الحرام والشبهات سنتجنب لو أننا اتبعنا منهج ذلك الفقير الورع

وقلنا كلما دعتنا أنفسنا لشهوة زائدة على حاجتنا ‘ كأنني أكلت ‘

شكرا لك الأخت بيرلا على العبرة

سفيان القاسمي
2012-02-09, 12:03
أدعوا الله لي بالشفاء

سفيان القاسمي
2012-02-09, 12:08
إليكم هذه العبرة
خرجت إمرأه من منزلها فرأت ثلاثة شيوخ لهم لحى بيضاء طويلة وكانوا جالسين في فناء منزلها لم تعرفهم.
وقالت: لا أظنني اعرفكم ولكن لابد أنكم جوعى. ارجوكم تفضلوا بالدخول لتأكلوا.
سألوها: هل رب البيت موجود؟
فأجابت :لا، إنه بالخارج.
فردوا: إذن لا يمكننا الدخول
في المساء وعندما عاد زوجها أخبرته بما حدث.
قال لها :إذهبي اليهم واطلبي منهم أن يدخلوا!
فخرجت المرأة و طلبت إليهم أن يدخلوا.
فردوا: نحن لا ندخل المنزل مجتمعين.
سألتهم :لماذا؟
فأوضح لها أحدهم قائلا: هذا اسمه (الثروة) وهو يومئ نحو احد اصدقائه ، وهذا (النجاح) وهو يومئ نحو الآخر وأنا (المحبة) ،
وأكمل قائلا: والآن ادخلي وتناقشي مع زوجك من منا تريدان أن يدخل منزلكم
دخلت المرأة واخبرت زوجها ما قيل.
فغمرت السعادة زوجها وقال: ياله من شئ حسن، وطالما كان الأمر على هذا النحو فلندعوا (الثروة).دعيه يدخل ليمتلئ منزلنا بالثراء!
فخالفته زوجته قائلة: عزيزي، لم لا ندعو (النجاح)؟
كل ذلك كان على مسمع من زوجة ابنهم وهي في احد زوايا المنزل.
فأسرعت باقتراحها قائلة: اليس من الأجدر ان ندعوا (المحبة)؟ فمنزلنا حينها سيمتلئ بالحب!
فقال الزوج: دعونا نأخذ بنصيحة زوجة ابننا! أخرجي وادعي (المحبة) ليحل ضيفا علينا!
خرجت المرأة وسألت الشيوخ الثلاثة: أيكم (المحبة)؟ ارجو ان يتفضل بالدخول ليكون ضيفنا.
نهض (المحبة) وبدأ بالمشي نحو المنزل. فنهض الإثنان الآخران وتبعاه، وهي مندهشة
سألت المرأة كلا من (الثروة) و(النجاح)قائلة : لقد دعوت (المحبة ) فقط ، فلماذا تدخلان معه؟
فرد الشيخان: لو كنت دعوت (الثروة) أو (النجاح) لظل الإثنان الباقيان خارجا ، ولكن كونك دعوت (المحبة) فأينما يذهب نذهب معه.
أينما توجد المحبة، يوجد الثراء والنجاح.

كمال الاسلام
2012-02-09, 12:08
أدعوا الله لي بالشفاء

اسأل الله العظيم رب العرش العظيم أن يشفيك.
اللهم رب الناس مذهب البأس اشف أنت الشافي لا شافي إلا أنت.

سفيان القاسمي
2012-02-09, 12:16
أتدرون من هم أسعد الناس؟؟؟؟؟

بسْمِ اللَّهِ الرَّحْمَنِ الرَّحِيمِ .

يَوْمَ يَأْتِ لَا تَكَلَّمُ نَفْسٌ إِلَّا بِإِذْنِهِ فَمِنْهُمْ شَقِيٌّ وَسَعِيدٌ (105) فَأَمَّا الَّذِينَ شَقُوا فَفِي النَّارِ لَهُمْ فِيهَا زَفِيرٌ وَشَهِيقٌ (106) خَالِدِينَ فِيهَا مَا دَامَتِ السَّمَوَاتُ وَالْأَرْضُ إِلَّا مَا شَاءَ رَبُّكَ إِنَّ رَبَّكَ فَعَّالٌ لِمَا يُرِيدُ (107) وَأَمَّا الَّذِينَ سُعِدُوا فَفِي الْجَنَّةِ خَالِدِينَ فِيهَا مَا دَامَتِ السَّمَوَاتُ وَالْأَرْضُ إِلَّا مَا شَاءَ رَبُّكَ عَطَاءً غَيْرَ مَجْذُوذٍ (108)

سورة هود

أخبرنا الله سبحانه وتعالى بإن أسعد الناس هم : (الَّذِينَ سُعِدُوا فَفِي الْجَنَّةِ خَالِدِينَ فِيهَا ) .

اللهم اجعلنا من أهل الجنة يا رب العالمين

سفيان القاسمي
2012-02-09, 12:18
عَنْ عُبَيْدِ اللَّهِ بْنِ مِحْصَنٍ الْخَطْمِيِّ رَضِيَ الله عَنْهُ قَالَ قَالَ رَسُولُ اللَّهِ صَلَّى اللَّهُ عَلَيْهِ وَسَلَّمَ:
"مَنْ أَصْبَحَ مِنْكُمْ آمِنًا فِي سِرْبِهِ مُعَافًى فِي جَسَدِهِ عِنْدَهُ قُوتُ يَوْمِهِ فَكَأَنَّمَا حِيزَتْ لَهُ الدُّنْيَا بِحَذَافِيرِهَا".
أخرجه البخاري

اللهم صل وسلم وبارك على سيدنا محمد النبى الأمى وعلى آل وأصحابه أجمعين .

سفيان القاسمي
2012-02-09, 12:19
اسأل الله العظيم رب العرش العظيم أن يشفيك.

اللهم رب الناس مذهب البأس اشف أنت الشافي لا شافي إلا أنت.

بارك الرحمن فيك أخي المشتاق للجنان
وأبعد عنك كل أذى

مبْدِعَـﮧْ حَتَّى فِي ـأَخْطَآْئِي
2012-02-09, 12:20
أدعوا الله لي بالشفاء

طهُورٌ انْ شَآء {الله}

شَفَآك {الله} و عَآفَآك

سفيان القاسمي
2012-02-09, 12:25
أتدرون من هو اشقى الناس؟؟؟؟
اشقى الناس من باع أخرته بدنيا غيره !!!
قال تعالى :
(قل هل ننبئكم بالأخسرين اعمالا الذين ضل سعيهم فى الحياة الدنيا وهم يحسبون انهم يحسنون صنعا)

اللهم ارحمنا برحمتك يا أرحم الراحمين

سفيان القاسمي
2012-02-09, 12:28
طهُورٌ انْ شَآء {الله}

شَفَآك {الله} و عَآفَآك

بارك الإله فيك أختي
مبدعة في أخطائي
مبدعة في أفكارك
جعل الله سعيك مشكور
وذنبك مغفور

سفيان القاسمي
2012-02-09, 12:32
طهُورٌ انْ شَآء {الله}

شَفَآك {الله} و عَآفَآك

بارك الإله فيك أختاه
أسأل الله أن يثبت قدمك يوم تزول الأقدام
يا قويّ يا عزيز

سفيان القاسمي
2012-02-09, 12:38
للمحبي أشواق والشوق في الله أعظم
وبينهم وصال ووصال الدعاء أدوم
إشتقنا لكم فما ضاعت مودتكم
وما ارتضيناكم لغير الوِدِّ عنوان
إزدادت في القلب محبّتكم
وصرتم في العين سُكَّان
سلامي بقدر احترامي للجميع

معاً إلى الله
2012-02-09, 12:38
السلام عليكم و رحمة الله و بركاته

طابت أوقات الجميع ,,,
أتمنى أن تكونوا كلكم بألف خير ,,,

أعتذر عن الغياب الذي سجلته ,,,
و يؤسفني أن أقول أن جهازي قد تعطل منذ أن حملت الملف أمس,,,الخاص ببرنامج الفيرفوكس الذي وضعه الأخ عقبة,,,

قيل لي أنه فايروس ,, لذلك أنصحكم بالتأكد قبل تحميل اي برنامج

أكتب لكم من جهاز غير جهازي ,,
و الى أن يقدر الله ان ينصلح الجهاز ,,
كونوا بألف خير و أتمنى لكم أوقات طيبة ,,

كما أطمع أن لا تنسوني من دعائكم في ظهر الغيب ,,

بحاجة له ,,
سلامي ,,

سفيان القاسمي
2012-02-09, 12:40
لنا عودة بإذن الرحمن
سلامي للجميع


سفيان القاسمي
2012-02-09, 12:44
السلام عليكم و رحمة الله و بركاته

طابت أوقات الجميع ,,,
أتمنى أن تكونوا كلكم بألف خير ,,,

أعتذر عن الغياب الذي سجلته ,,,
و يؤسفني أن أقول أن جهازي قد تعطل منذ أن حملت الملف أمس,,,الخاص ببرنامج الفيرفوكس الذي وضعه الأخ عقبة,,,

قيل لي أنه فايروس ,, لذلك أنصحكم بالتأكد قبل تحميل اي برنامج

أكتب لكم من جهاز غير جهازي ,,
و الى أن يقدر الله ان ينصلح الجهاز ,,
كونوا بألف خير و أتمنى لكم أوقات طيبة ,,

كما أطمع أن لا تنسوني من دعائكم في ظهر الغيب ,,

بحاجة له ,,

سلامي ,,

أن شاء الله تعودي إلينا بالف عااااااااااافيه
اللهم سهل لها أمورها
برحمتك يا أرحم الراحمين

معاً إلى الله
2012-02-09, 12:48
أن شاء الله تعودي إلينا بالف عااااااااااافيه

اللهم سهل لها أمورها

برحمتك يا أرحم الراحمين

اللهم آميــــــــــــــــــن يا رب العالمين ,,

بارك الله فيك أخي الكريم سفيان ,,
عساك بألف خير ,, افتقدنا توآجدك معنآ ,,
ربي يحفظك و ينور دربك ,,

و افتقدتُ تواجدي معكم ,, الله المستعان ,,

آلاء الرحـــــــمن
2012-02-09, 12:54
اهلا بعودتك اختي معا الى الله
عاودي فورماتي ميكروك وستاليه من جديد
يبدو انها مجموعة من الفيروسات وليس فيروس واحد
كي تعاودي تسطاليه استالي افاست مليح

محمد جديدي التبسي
2012-02-09, 12:56
السلام عليكم ورحمة الله وبركاته

انا الآن أستخدم المتصفح الذي حملته من رابط أخي عقبة وهو يمشي منذ الأمس والحمد لله
أظن أن الفيروس جاءك من جهة أخرى
عموما وفقك الله وننتظر عودتك يا صاحبة الدار فمن دونك الدار باردة والضوء ناقص وحتى المأكولات لا توجد راه قتلنا الجوع ههه :)

آلاء الرحـــــــمن
2012-02-09, 13:00
اخي سفيان القاسمي شكرا لك على قصة الشيوخ الثلاث فعلا معبرة
وشفاك الله من كل مرض وابعد عنك كل هم وغم
مرحبا بك في اي وقت و لا تطل علينا الغياب

آلاء الرحـــــــمن
2012-02-09, 13:03
السلام عليكم ورحمة الله وبركاته

انا الآن أستخدم المتصفح الذي حملته من رابط أخي عقبة وهو يمشي منذ الأمس والحمد لله
أظن أن الفيروس جاءك من جهة أخرى
عموما وفقك الله وننتظر عودتك يا صاحبة الدار فمن دونك الدار باردة والضوء ناقص وحتى المأكولات لا توجد راه قتلنا الجوع ههه :)
وعليكم السلام ورحمة الله تعالى وبركاته
اخي لموكان علمتنا نحضرولك اطيب واشهى المأكولات
وزيد رانا اصلا نسالوك راك ما جبتلنا والو من مأكولات تبسة ولا عند بالك رانا نسينا
نحن في انتظار عادات وتقاليد تبسة و مأكولاتها الطيبة
بارك الله فيك

نور على نور
2012-02-09, 13:05
حِينَ تخآفُ { الله } فِيْ آلأنثِىَ ~
وَ تكُونُ لَھآ آلسَّندِ فِيْ آلِحَيآھِ !
ثِق تَمَآمَاً بأنَّكَ وَصِلتَ لِمَرحَلَة :

آلِكَمآلْ فِيْ آلْرُّجُولَة